BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0454.Seq (648 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q8I470 Cluster: 4-diphosphocytidyl-2c-methyl-D-erythrit... 33 6.0 UniRef50_Q3U134 Cluster: Activated spleen cDNA, RIKEN full-lengt... 33 7.9 >UniRef50_Q8I470 Cluster: 4-diphosphocytidyl-2c-methyl-D-erythritol kinase (CMK), putative; n=3; Plasmodium|Rep: 4-diphosphocytidyl-2c-methyl-D-erythritol kinase (CMK), putative - Plasmodium falciparum (isolate 3D7) Length = 537 Score = 33.1 bits (72), Expect = 6.0 Identities = 20/80 (25%), Positives = 42/80 (52%) Frame = -2 Query: 503 NSNSFYVNDLKTFLHSFIQRIQDLCFSKRLYKMHEVCVLNCFLFTNLFFIKNKQ*MFSDV 324 N + +VNDL+ I+++QDL R M +V ++ ++LF + NK+ ++ Sbjct: 429 NLQNVFVNDLEHSAFYLIKKLQDLKEYLRSQNMFDVVSMS-GSGSSLFALSNKKTQTHEI 487 Query: 323 FRRRKNNKLKKYIPNVLLSY 264 +N ++KK I ++ + + Sbjct: 488 SSSFQNERIKKLISDIKIKF 507 >UniRef50_Q3U134 Cluster: Activated spleen cDNA, RIKEN full-length enriched library, clone:F830016D02 product:hypothetical protein, full insert sequence; n=2; Mus musculus|Rep: Activated spleen cDNA, RIKEN full-length enriched library, clone:F830016D02 product:hypothetical protein, full insert sequence - Mus musculus (Mouse) Length = 121 Score = 32.7 bits (71), Expect = 7.9 Identities = 17/62 (27%), Positives = 31/62 (50%), Gaps = 1/62 (1%) Frame = -3 Query: 517 VTSLKI-LIVFT*MI*KHFYIHSFREFKIYVSLNVCIRCTKYVS*IVFFLLICFSLKISS 341 +T K+ L F+ I + Y H+ IY+ + VC+ C KY+ I+ L++ + + Sbjct: 38 ITMAKMGLYNFSSFISAYIYTHTHTHTYIYIYIYVCV-CVKYILTIIILLIMIINYSVKI 96 Query: 340 KC 335 C Sbjct: 97 HC 98 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 520,854,354 Number of Sequences: 1657284 Number of extensions: 9442198 Number of successful extensions: 17094 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 16371 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17086 length of database: 575,637,011 effective HSP length: 97 effective length of database: 414,880,463 effective search space used: 48955894634 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -