BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0454.Seq (648 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY536865-1|AAT07965.1| 650|Anopheles gambiae tryptophan transpo... 29 0.096 AJ626713-1|CAF25029.1| 650|Anopheles gambiae tryptophan transpo... 29 0.096 >AY536865-1|AAT07965.1| 650|Anopheles gambiae tryptophan transporter protein. Length = 650 Score = 29.5 bits (63), Expect = 0.096 Identities = 17/58 (29%), Positives = 27/58 (46%), Gaps = 1/58 (1%) Frame = +3 Query: 474 QIIYVKTIRILRLVTMCLMHVIFYSTYNTL*TNL-SDRTIYKIFKINFGSLCRLXAFG 644 ++ Y ++ +T+C +V+ YS+YN N+ D TI I L L FG Sbjct: 319 KVWYAAVTQVFFSLTICFGNVMMYSSYNRFHNNVYRDVTIVSIMDTLTSMLAGLIVFG 376 >AJ626713-1|CAF25029.1| 650|Anopheles gambiae tryptophan transporter protein. Length = 650 Score = 29.5 bits (63), Expect = 0.096 Identities = 17/58 (29%), Positives = 27/58 (46%), Gaps = 1/58 (1%) Frame = +3 Query: 474 QIIYVKTIRILRLVTMCLMHVIFYSTYNTL*TNL-SDRTIYKIFKINFGSLCRLXAFG 644 ++ Y ++ +T+C +V+ YS+YN N+ D TI I L L FG Sbjct: 319 KVWYAAVTQVFFSLTICFGNVMMYSSYNRFHNNVYRDVTIVSIMDTLTSMLAGLIVFG 376 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 578,751 Number of Sequences: 2352 Number of extensions: 10954 Number of successful extensions: 12 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 63977715 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -