BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0451.Seq (588 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different... 26 1.0 AY324313-1|AAQ89698.1| 160|Anopheles gambiae insulin-like pepti... 25 1.4 AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-spe... 25 1.8 L76038-1|AAC27383.1| 683|Anopheles gambiae prophenoloxidase pro... 24 4.2 AF395079-1|AAK97461.1| 371|Anopheles gambiae basic helix-loop-h... 24 4.2 AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-spe... 24 4.2 AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-spe... 24 4.2 AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-spe... 24 4.2 AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-spe... 24 4.2 AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-spe... 24 4.2 AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-spe... 24 4.2 AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-spe... 24 4.2 AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-spe... 24 4.2 AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cut... 24 4.2 AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-spe... 24 4.2 AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-spe... 24 4.2 AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-spe... 24 4.2 AF031626-1|AAD01936.1| 683|Anopheles gambiae prophenoloxidase p... 24 4.2 AB090822-1|BAC57919.1| 468|Anopheles gambiae gag-like protein p... 23 5.5 DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methopren... 23 9.7 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 23 9.7 AJ535204-1|CAD59404.1| 1187|Anopheles gambiae SMC2 protein protein. 23 9.7 >AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative differentiation regulator protein. Length = 1283 Score = 25.8 bits (54), Expect = 1.0 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = -1 Query: 576 RREKKKMKSEQDEAEREKEKA 514 +REK++ + EQ E ERE+E A Sbjct: 502 QREKEQREREQREKEREREAA 522 >AY324313-1|AAQ89698.1| 160|Anopheles gambiae insulin-like peptide 6 precursor protein. Length = 160 Score = 25.4 bits (53), Expect = 1.4 Identities = 13/51 (25%), Positives = 25/51 (49%), Gaps = 1/51 (1%) Frame = +2 Query: 188 PHVHGYQYETTDTYLLTHNMSLQS-VKFEPNTRTVLKTNDNSIGIVEDCAT 337 P +H + D + +M+ + + E NT+ +L S+G+ +D AT Sbjct: 50 PDLHTTSKRSADNFAKPSDMATEDWMNVEDNTQQILDQQLQSVGMPDDRAT 100 >AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 25.0 bits (52), Expect = 1.8 Identities = 15/48 (31%), Positives = 21/48 (43%) Frame = +1 Query: 358 SPRTHTTYPEVLNVLALTN*SQQPTAHRVPPQALRLQSHRRGPHHLPH 501 +P H + P + +T+ + P AH P A S GP HL H Sbjct: 182 APIAHYSAPIAHHAAPITHYAA-PIAHHAAPIAHSTSSIVHGPSHLSH 228 >L76038-1|AAC27383.1| 683|Anopheles gambiae prophenoloxidase protein. Length = 683 Score = 23.8 bits (49), Expect = 4.2 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +2 Query: 233 LTHNMSLQSVKFEPNTRTVLKT 298 LT NM++QS+ N RTV +T Sbjct: 661 LTPNMAVQSITVVHNDRTVNRT 682 >AF395079-1|AAK97461.1| 371|Anopheles gambiae basic helix-loop-helix transcriptionfactor ASH protein. Length = 371 Score = 23.8 bits (49), Expect = 4.2 Identities = 10/26 (38%), Positives = 12/26 (46%) Frame = +1 Query: 421 QQPTAHRVPPQALRLQSHRRGPHHLP 498 QQ H+ PQ Q + PHH P Sbjct: 309 QQHHHHQHQPQQQHQQQYHSHPHHTP 334 >AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 23.8 bits (49), Expect = 4.2 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 427 PTAHRVPPQALRLQSHRRGPHHLPH 501 P AH P A S GP HL H Sbjct: 205 PIAHHAAPIAHSTSSIVHGPSHLSH 229 >AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 231 Score = 23.8 bits (49), Expect = 4.2 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 427 PTAHRVPPQALRLQSHRRGPHHLPH 501 P AH P A S GP HL H Sbjct: 204 PIAHHAAPIAHSTSSIVHGPSHLSH 228 >AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 23.8 bits (49), Expect = 4.2 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 427 PTAHRVPPQALRLQSHRRGPHHLPH 501 P AH P A S GP HL H Sbjct: 204 PIAHHAAPIAHSTSSIVHGPSHLSH 228 >AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 234 Score = 23.8 bits (49), Expect = 4.2 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 427 PTAHRVPPQALRLQSHRRGPHHLPH 501 P AH P A S GP HL H Sbjct: 207 PIAHHAAPIAHSTSSIVHGPSHLSH 231 >AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 23.8 bits (49), Expect = 4.2 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 427 PTAHRVPPQALRLQSHRRGPHHLPH 501 P AH P A S GP HL H Sbjct: 212 PIAHHAAPIAHSTSSIVHGPSHLSH 236 >AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 23.8 bits (49), Expect = 4.2 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 427 PTAHRVPPQALRLQSHRRGPHHLPH 501 P AH P A S GP HL H Sbjct: 204 PIAHHAAPIAHSTSSIVHGPSHLSH 228 >AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 23.8 bits (49), Expect = 4.2 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 427 PTAHRVPPQALRLQSHRRGPHHLPH 501 P AH P A S GP HL H Sbjct: 212 PIAHHAAPIAHSTSSIVHGPSHLSH 236 >AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 263 Score = 23.8 bits (49), Expect = 4.2 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 427 PTAHRVPPQALRLQSHRRGPHHLPH 501 P AH P A S GP HL H Sbjct: 236 PIAHHAAPIAHSTSSIVHGPSHLSH 260 >AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cuticular protein CP2b protein. Length = 231 Score = 23.8 bits (49), Expect = 4.2 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 427 PTAHRVPPQALRLQSHRRGPHHLPH 501 P AH P A S GP HL H Sbjct: 204 PIAHHAAPIAHSTSSIVHGPSHLSH 228 >AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 23.8 bits (49), Expect = 4.2 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 427 PTAHRVPPQALRLQSHRRGPHHLPH 501 P AH P A S GP HL H Sbjct: 205 PIAHHAAPIAHSTSSIVHGPSHLSH 229 >AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 23.8 bits (49), Expect = 4.2 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 427 PTAHRVPPQALRLQSHRRGPHHLPH 501 P AH P A S GP HL H Sbjct: 204 PIAHHAAPIAHSTSSIVHGPSHLSH 228 >AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 239 Score = 23.8 bits (49), Expect = 4.2 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 427 PTAHRVPPQALRLQSHRRGPHHLPH 501 P AH P A S GP HL H Sbjct: 212 PIAHHAAPIAHSTSSIVHGPSHLSH 236 >AF031626-1|AAD01936.1| 683|Anopheles gambiae prophenoloxidase protein. Length = 683 Score = 23.8 bits (49), Expect = 4.2 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +2 Query: 233 LTHNMSLQSVKFEPNTRTVLKT 298 LT NM++QS+ N RTV +T Sbjct: 661 LTPNMAVQSITVVHNDRTVNRT 682 >AB090822-1|BAC57919.1| 468|Anopheles gambiae gag-like protein protein. Length = 468 Score = 23.4 bits (48), Expect = 5.5 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = -1 Query: 564 KKMKSEQDEAEREKEKA 514 KK + ++EA R+KEKA Sbjct: 82 KKSRETKEEARRDKEKA 98 >DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methoprene-tolerant protein protein. Length = 1115 Score = 22.6 bits (46), Expect = 9.7 Identities = 9/27 (33%), Positives = 12/27 (44%) Frame = +1 Query: 421 QQPTAHRVPPQALRLQSHRRGPHHLPH 501 QQP+++ Q H HH PH Sbjct: 167 QQPSSYHQQQHPGHSQHHHHHHHHHPH 193 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 22.6 bits (46), Expect = 9.7 Identities = 6/20 (30%), Positives = 14/20 (70%) Frame = -1 Query: 351 FLKPLVAQSSTIPILLSFVF 292 F+ P + S++P+ ++F+F Sbjct: 38 FVSPSCLECSSVPLFINFIF 57 >AJ535204-1|CAD59404.1| 1187|Anopheles gambiae SMC2 protein protein. Length = 1187 Score = 22.6 bits (46), Expect = 9.7 Identities = 10/24 (41%), Positives = 17/24 (70%) Frame = -1 Query: 582 KGRREKKKMKSEQDEAEREKEKAE 511 KG RE++ +E+D +R K+K+E Sbjct: 782 KGHRERELKSAEED-LKRSKKKSE 804 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 546,730 Number of Sequences: 2352 Number of extensions: 11752 Number of successful extensions: 33 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 30 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 33 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 56347938 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -