BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0448.Seq (598 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 ... 25 0.64 AY531876-2|AAT08871.1| 340|Tribolium castaneum tyrosine recombi... 23 1.5 AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone recepto... 22 4.5 AM292378-1|CAL23190.2| 387|Tribolium castaneum gustatory recept... 21 6.0 EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 prot... 21 7.9 >AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 protein protein. Length = 371 Score = 24.6 bits (51), Expect = 0.64 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = -2 Query: 138 GSNIWSLLNPPHPQNSPTTTRRAA*IYNSYN 46 GSN SL+ P P SP + YNS+N Sbjct: 258 GSNTSSLITTPSPSASPLAYQHE---YNSFN 285 >AY531876-2|AAT08871.1| 340|Tribolium castaneum tyrosine recombinase protein. Length = 340 Score = 23.4 bits (48), Expect = 1.5 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = -3 Query: 182 PSSYQQLGREFKKLLAPISGVSSIHLTHKT 93 P+S Q L R K +LA +SI+ H T Sbjct: 260 PASTQSLSRWIKMVLAESGVDTSIYTAHST 289 >AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone receptor (isoform A) protein. Length = 549 Score = 21.8 bits (44), Expect = 4.5 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 417 RASGYHHPAYFC 382 RASGYH+ A C Sbjct: 194 RASGYHYNALTC 205 >AM292378-1|CAL23190.2| 387|Tribolium castaneum gustatory receptor candidate 57 protein. Length = 387 Score = 21.4 bits (43), Expect = 6.0 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = +1 Query: 262 WLLEPMDIYNVNAPPTLRYK 321 WL P + N P +LR+K Sbjct: 7 WLTPPHSLGNTVTPVSLRFK 26 >EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 protein. Length = 475 Score = 21.0 bits (42), Expect = 7.9 Identities = 8/25 (32%), Positives = 14/25 (56%), Gaps = 1/25 (4%) Frame = -2 Query: 366 RFEGWGSRCNY-ETLELISQGGWRI 295 ++ G Y E +EL +GGW++ Sbjct: 289 KYTGEAGMLGYNEIVELQKEGGWKV 313 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 145,624 Number of Sequences: 336 Number of extensions: 2980 Number of successful extensions: 11 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15039504 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -