BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0448.Seq (598 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. 25 1.4 AY748849-1|AAV28195.1| 106|Anopheles gambiae cytochrome P450 pr... 23 9.9 >AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. Length = 1009 Score = 25.4 bits (53), Expect = 1.4 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 358 FKTHYCFTAEIGRVVVPTRADSQEVLPS 441 F H F AEIG +V DS E+LP+ Sbjct: 936 FHCHIEFHAEIGMSLVLKVGDSSEMLPA 963 >AY748849-1|AAV28195.1| 106|Anopheles gambiae cytochrome P450 protein. Length = 106 Score = 22.6 bits (46), Expect = 9.9 Identities = 11/38 (28%), Positives = 21/38 (55%) Frame = -1 Query: 403 PPPCLFLP*SSNAF*RMGQPL*L*DLRTYISRWVAHLR 290 PPP +LP S+ +GQ + +++T + R ++ R Sbjct: 67 PPPYSYLPFSTGVRSCIGQRFAMLEMKTVLVRLLSRFR 104 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 636,298 Number of Sequences: 2352 Number of extensions: 12987 Number of successful extensions: 18 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 57609459 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -