BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0445.Seq (449 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_23612| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_22693| Best HMM Match : DUF1042 (HMM E-Value=0.00027) 29 2.3 SB_15448| Best HMM Match : Utp11 (HMM E-Value=0.89) 28 3.1 SB_57710| Best HMM Match : bZIP_1 (HMM E-Value=0.32) 28 4.1 SB_23419| Best HMM Match : zf-A20 (HMM E-Value=1.8e-37) 28 4.1 >SB_23612| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1021 Score = 29.1 bits (62), Expect = 1.8 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 106 QSPSATSVGSGSRSPTKASAGPRTA 180 QSPSA S+GS RSP G RT+ Sbjct: 753 QSPSADSLGSSVRSPPPPYPGSRTS 777 >SB_22693| Best HMM Match : DUF1042 (HMM E-Value=0.00027) Length = 2261 Score = 28.7 bits (61), Expect = 2.3 Identities = 20/41 (48%), Positives = 23/41 (56%), Gaps = 3/41 (7%) Frame = +1 Query: 94 IKMPQSPSATSV--GSGSRSPTKAS-AGPRTASGSTVRQRK 207 +K +SPS TS GS SRSP+ S G R AS S RK Sbjct: 1187 VKKDRSPSPTSKKGGSKSRSPSPTSKKGSRAASKSPSASRK 1227 >SB_15448| Best HMM Match : Utp11 (HMM E-Value=0.89) Length = 1328 Score = 28.3 bits (60), Expect = 3.1 Identities = 12/37 (32%), Positives = 22/37 (59%) Frame = +3 Query: 72 SKVLQRLNKNASISECYLCRIWE*ITHKSFCWPTNSQ 182 +K+LQR++K+ + LC +E I K+ P N++ Sbjct: 517 TKLLQRMSKDHQVLNKMLCEEYEKIAEKALTSPANTE 553 >SB_57710| Best HMM Match : bZIP_1 (HMM E-Value=0.32) Length = 584 Score = 27.9 bits (59), Expect = 4.1 Identities = 19/37 (51%), Positives = 21/37 (56%), Gaps = 6/37 (16%) Frame = +1 Query: 109 SPSATSVGSGSR-----SPTK-ASAGPRTASGSTVRQ 201 SP TSVGSGSR +PT ASA P + G RQ Sbjct: 322 SPMLTSVGSGSRTGSPAAPTNAASASPGKSGGPEERQ 358 >SB_23419| Best HMM Match : zf-A20 (HMM E-Value=1.8e-37) Length = 1188 Score = 27.9 bits (59), Expect = 4.1 Identities = 15/32 (46%), Positives = 17/32 (53%), Gaps = 2/32 (6%) Frame = +1 Query: 103 PQSPSATSVGS--GSRSPTKASAGPRTASGST 192 P P SVG+ G PT A AGP+ AS T Sbjct: 545 PAGPQHASVGTSMGQSQPTHAPAGPQQASVGT 576 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,828,129 Number of Sequences: 59808 Number of extensions: 176870 Number of successful extensions: 373 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 356 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 372 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 896151577 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -