BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0443.Seq (598 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY825832-1|AAV70395.1| 168|Anopheles gambiae heat shock protein... 24 4.3 AY825831-1|AAV70394.1| 168|Anopheles gambiae heat shock protein... 24 4.3 AY825830-1|AAV70393.1| 169|Anopheles gambiae heat shock protein... 24 4.3 AY825829-1|AAV70392.1| 169|Anopheles gambiae heat shock protein... 24 4.3 AY825828-1|AAV70391.1| 172|Anopheles gambiae heat shock protein... 24 4.3 AY825827-1|AAV70390.1| 172|Anopheles gambiae heat shock protein... 24 4.3 AY825826-1|AAV70389.1| 169|Anopheles gambiae heat shock protein... 24 4.3 AY825825-1|AAV70388.1| 169|Anopheles gambiae heat shock protein... 24 4.3 AY825824-1|AAV70387.1| 161|Anopheles gambiae heat shock protein... 24 4.3 AY825823-1|AAV70386.1| 161|Anopheles gambiae heat shock protein... 24 4.3 AY825822-1|AAV70385.1| 159|Anopheles gambiae heat shock protein... 24 4.3 AY825821-1|AAV70384.1| 159|Anopheles gambiae heat shock protein... 24 4.3 AY825820-1|AAV70383.1| 168|Anopheles gambiae heat shock protein... 24 4.3 AY825819-1|AAV70382.1| 168|Anopheles gambiae heat shock protein... 24 4.3 AY825818-1|AAV70381.1| 168|Anopheles gambiae heat shock protein... 24 4.3 AY825817-1|AAV70380.1| 168|Anopheles gambiae heat shock protein... 24 4.3 AY825816-1|AAV70379.1| 162|Anopheles gambiae heat shock protein... 24 4.3 AY825815-1|AAV70378.1| 162|Anopheles gambiae heat shock protein... 24 4.3 AY825814-1|AAV70377.1| 169|Anopheles gambiae heat shock protein... 24 4.3 AY825813-1|AAV70376.1| 169|Anopheles gambiae heat shock protein... 24 4.3 AY825812-1|AAV70375.1| 168|Anopheles gambiae heat shock protein... 24 4.3 AY825811-1|AAV70374.1| 168|Anopheles gambiae heat shock protein... 24 4.3 AY825810-1|AAV70373.1| 169|Anopheles gambiae heat shock protein... 24 4.3 AY825809-1|AAV70372.1| 169|Anopheles gambiae heat shock protein... 24 4.3 AY825808-1|AAV70371.1| 171|Anopheles gambiae heat shock protein... 24 4.3 AY825807-1|AAV70370.1| 171|Anopheles gambiae heat shock protein... 24 4.3 AY825806-1|AAV70369.1| 168|Anopheles gambiae heat shock protein... 24 4.3 AY825805-1|AAV70368.1| 168|Anopheles gambiae heat shock protein... 24 4.3 AY825804-1|AAV70367.1| 168|Anopheles gambiae heat shock protein... 24 4.3 AY825803-1|AAV70366.1| 168|Anopheles gambiae heat shock protein... 24 4.3 AY825802-1|AAV70365.1| 168|Anopheles gambiae heat shock protein... 24 4.3 AY825801-1|AAV70364.1| 168|Anopheles gambiae heat shock protein... 24 4.3 AY825800-1|AAV70363.1| 171|Anopheles gambiae heat shock protein... 24 4.3 AY825799-1|AAV70362.1| 171|Anopheles gambiae heat shock protein... 24 4.3 AY825798-1|AAV70361.1| 168|Anopheles gambiae heat shock protein... 24 4.3 AY825797-1|AAV70360.1| 168|Anopheles gambiae heat shock protein... 24 4.3 AY825796-1|AAV70359.1| 174|Anopheles gambiae heat shock protein... 24 4.3 AY825795-1|AAV70358.1| 174|Anopheles gambiae heat shock protein... 24 4.3 AY825794-1|AAV70357.1| 169|Anopheles gambiae heat shock protein... 24 4.3 AY825793-1|AAV70356.1| 169|Anopheles gambiae heat shock protein... 24 4.3 AY825792-1|AAV70355.1| 153|Anopheles gambiae heat shock protein... 24 4.3 AY825791-1|AAV70354.1| 153|Anopheles gambiae heat shock protein... 24 4.3 AY825790-1|AAV70353.1| 168|Anopheles gambiae heat shock protein... 24 4.3 AY825789-1|AAV70352.1| 168|Anopheles gambiae heat shock protein... 24 4.3 AY825788-1|AAV70351.1| 168|Anopheles gambiae heat shock protein... 24 4.3 AY825787-1|AAV70350.1| 168|Anopheles gambiae heat shock protein... 24 4.3 AY825786-1|AAV70349.1| 168|Anopheles gambiae heat shock protein... 24 4.3 AY825785-1|AAV70348.1| 168|Anopheles gambiae heat shock protein... 24 4.3 AY825784-1|AAV70347.1| 168|Anopheles gambiae heat shock protein... 24 4.3 AY825783-1|AAV70346.1| 168|Anopheles gambiae heat shock protein... 24 4.3 AY825782-1|AAV70345.1| 168|Anopheles gambiae heat shock protein... 24 4.3 AY825781-1|AAV70344.1| 168|Anopheles gambiae heat shock protein... 24 4.3 AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcript... 23 7.5 AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 23 9.9 AY578809-1|AAT07314.1| 358|Anopheles gambiae Sloan-Kettering In... 23 9.9 AF364130-1|AAL35506.1| 417|Anopheles gambiae putative odorant r... 23 9.9 >AY825832-1|AAV70395.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 4.3 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 1 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 96 +Y F D DI L+HR+S + Y NI+ Sbjct: 54 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 85 >AY825831-1|AAV70394.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 4.3 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 1 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 96 +Y F D DI L+HR+S + Y NI+ Sbjct: 54 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 85 >AY825830-1|AAV70393.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.8 bits (49), Expect = 4.3 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 1 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 96 +Y F D DI L+HR+S + Y NI+ Sbjct: 55 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 86 >AY825829-1|AAV70392.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.8 bits (49), Expect = 4.3 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 1 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 96 +Y F D DI L+HR+S + Y NI+ Sbjct: 55 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 86 >AY825828-1|AAV70391.1| 172|Anopheles gambiae heat shock protein DnaJ protein. Length = 172 Score = 23.8 bits (49), Expect = 4.3 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 1 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 96 +Y F D DI L+HR+S + Y NI+ Sbjct: 55 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 86 >AY825827-1|AAV70390.1| 172|Anopheles gambiae heat shock protein DnaJ protein. Length = 172 Score = 23.8 bits (49), Expect = 4.3 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 1 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 96 +Y F D DI L+HR+S + Y NI+ Sbjct: 55 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 86 >AY825826-1|AAV70389.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.8 bits (49), Expect = 4.3 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 1 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 96 +Y F D DI L+HR+S + Y NI+ Sbjct: 55 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 86 >AY825825-1|AAV70388.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.8 bits (49), Expect = 4.3 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 1 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 96 +Y F D DI L+HR+S + Y NI+ Sbjct: 55 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 86 >AY825824-1|AAV70387.1| 161|Anopheles gambiae heat shock protein DnaJ protein. Length = 161 Score = 23.8 bits (49), Expect = 4.3 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 1 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 96 +Y F D DI L+HR+S + Y NI+ Sbjct: 40 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 71 >AY825823-1|AAV70386.1| 161|Anopheles gambiae heat shock protein DnaJ protein. Length = 161 Score = 23.8 bits (49), Expect = 4.3 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 1 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 96 +Y F D DI L+HR+S + Y NI+ Sbjct: 40 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 71 >AY825822-1|AAV70385.1| 159|Anopheles gambiae heat shock protein DnaJ protein. Length = 159 Score = 23.8 bits (49), Expect = 4.3 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 1 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 96 +Y F D DI L+HR+S + Y NI+ Sbjct: 42 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 73 >AY825821-1|AAV70384.1| 159|Anopheles gambiae heat shock protein DnaJ protein. Length = 159 Score = 23.8 bits (49), Expect = 4.3 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 1 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 96 +Y F D DI L+HR+S + Y NI+ Sbjct: 42 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 73 >AY825820-1|AAV70383.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 4.3 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 1 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 96 +Y F D DI L+HR+S + Y NI+ Sbjct: 54 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 85 >AY825819-1|AAV70382.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 4.3 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 1 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 96 +Y F D DI L+HR+S + Y NI+ Sbjct: 54 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 85 >AY825818-1|AAV70381.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 4.3 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 1 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 96 +Y F D DI L+HR+S + Y NI+ Sbjct: 54 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 85 >AY825817-1|AAV70380.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 4.3 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 1 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 96 +Y F D DI L+HR+S + Y NI+ Sbjct: 54 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 85 >AY825816-1|AAV70379.1| 162|Anopheles gambiae heat shock protein DnaJ protein. Length = 162 Score = 23.8 bits (49), Expect = 4.3 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 1 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 96 +Y F D DI L+HR+S + Y NI+ Sbjct: 45 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 76 >AY825815-1|AAV70378.1| 162|Anopheles gambiae heat shock protein DnaJ protein. Length = 162 Score = 23.8 bits (49), Expect = 4.3 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 1 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 96 +Y F D DI L+HR+S + Y NI+ Sbjct: 45 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 76 >AY825814-1|AAV70377.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.8 bits (49), Expect = 4.3 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 1 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 96 +Y F D DI L+HR+S + Y NI+ Sbjct: 55 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 86 >AY825813-1|AAV70376.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.8 bits (49), Expect = 4.3 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 1 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 96 +Y F D DI L+HR+S + Y NI+ Sbjct: 55 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 86 >AY825812-1|AAV70375.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 4.3 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 1 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 96 +Y F D DI L+HR+S + Y NI+ Sbjct: 54 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 85 >AY825811-1|AAV70374.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 4.3 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 1 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 96 +Y F D DI L+HR+S + Y NI+ Sbjct: 54 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 85 >AY825810-1|AAV70373.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.8 bits (49), Expect = 4.3 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 1 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 96 +Y F D DI L+HR+S + Y NI+ Sbjct: 55 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 86 >AY825809-1|AAV70372.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.8 bits (49), Expect = 4.3 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 1 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 96 +Y F D DI L+HR+S + Y NI+ Sbjct: 55 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 86 >AY825808-1|AAV70371.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 23.8 bits (49), Expect = 4.3 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 1 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 96 +Y F D DI L+HR+S + Y NI+ Sbjct: 54 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 85 >AY825807-1|AAV70370.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 23.8 bits (49), Expect = 4.3 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 1 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 96 +Y F D DI L+HR+S + Y NI+ Sbjct: 54 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 85 >AY825806-1|AAV70369.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 4.3 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 1 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 96 +Y F D DI L+HR+S + Y NI+ Sbjct: 54 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 85 >AY825805-1|AAV70368.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 4.3 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 1 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 96 +Y F D DI L+HR+S + Y NI+ Sbjct: 54 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 85 >AY825804-1|AAV70367.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 4.3 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 1 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 96 +Y F D DI L+HR+S + Y NI+ Sbjct: 54 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 85 >AY825803-1|AAV70366.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 4.3 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 1 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 96 +Y F D DI L+HR+S + Y NI+ Sbjct: 54 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 85 >AY825802-1|AAV70365.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 4.3 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 1 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 96 +Y F D DI L+HR+S + Y NI+ Sbjct: 54 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 85 >AY825801-1|AAV70364.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 4.3 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 1 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 96 +Y F D DI L+HR+S + Y NI+ Sbjct: 54 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 85 >AY825800-1|AAV70363.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 23.8 bits (49), Expect = 4.3 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 1 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 96 +Y F D DI L+HR+S + Y NI+ Sbjct: 55 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 86 >AY825799-1|AAV70362.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 23.8 bits (49), Expect = 4.3 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 1 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 96 +Y F D DI L+HR+S + Y NI+ Sbjct: 55 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 86 >AY825798-1|AAV70361.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 4.3 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 1 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 96 +Y F D DI L+HR+S + Y NI+ Sbjct: 54 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 85 >AY825797-1|AAV70360.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 4.3 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 1 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 96 +Y F D DI L+HR+S + Y NI+ Sbjct: 54 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 85 >AY825796-1|AAV70359.1| 174|Anopheles gambiae heat shock protein DnaJ protein. Length = 174 Score = 23.8 bits (49), Expect = 4.3 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 1 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 96 +Y F D DI L+HR+S + Y NI+ Sbjct: 57 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 88 >AY825795-1|AAV70358.1| 174|Anopheles gambiae heat shock protein DnaJ protein. Length = 174 Score = 23.8 bits (49), Expect = 4.3 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 1 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 96 +Y F D DI L+HR+S + Y NI+ Sbjct: 57 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 88 >AY825794-1|AAV70357.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.8 bits (49), Expect = 4.3 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 1 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 96 +Y F D DI L+HR+S + Y NI+ Sbjct: 54 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 85 >AY825793-1|AAV70356.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.8 bits (49), Expect = 4.3 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 1 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 96 +Y F D DI L+HR+S + Y NI+ Sbjct: 54 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 85 >AY825792-1|AAV70355.1| 153|Anopheles gambiae heat shock protein DnaJ protein. Length = 153 Score = 23.8 bits (49), Expect = 4.3 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 1 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 96 +Y F D DI L+HR+S + Y NI+ Sbjct: 39 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 70 >AY825791-1|AAV70354.1| 153|Anopheles gambiae heat shock protein DnaJ protein. Length = 153 Score = 23.8 bits (49), Expect = 4.3 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 1 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 96 +Y F D DI L+HR+S + Y NI+ Sbjct: 39 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 70 >AY825790-1|AAV70353.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 4.3 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 1 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 96 +Y F D DI L+HR+S + Y NI+ Sbjct: 54 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 85 >AY825789-1|AAV70352.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 4.3 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 1 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 96 +Y F D DI L+HR+S + Y NI+ Sbjct: 54 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 85 >AY825788-1|AAV70351.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 4.3 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 1 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 96 +Y F D DI L+HR+S + Y NI+ Sbjct: 54 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 85 >AY825787-1|AAV70350.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 4.3 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 1 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 96 +Y F D DI L+HR+S + Y NI+ Sbjct: 54 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 85 >AY825786-1|AAV70349.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 4.3 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 1 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 96 +Y F D DI L+HR+S + Y NI+ Sbjct: 54 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 85 >AY825785-1|AAV70348.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 4.3 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 1 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 96 +Y F D DI L+HR+S + Y NI+ Sbjct: 54 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 85 >AY825784-1|AAV70347.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 4.3 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 1 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 96 +Y F D DI L+HR+S + Y NI+ Sbjct: 54 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 85 >AY825783-1|AAV70346.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 4.3 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 1 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 96 +Y F D DI L+HR+S + Y NI+ Sbjct: 54 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 85 >AY825782-1|AAV70345.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 4.3 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 1 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 96 +Y F D DI L+HR+S + Y NI+ Sbjct: 54 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 85 >AY825781-1|AAV70344.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 4.3 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 1 YYLPTKFVLSDSDILLHHRVSAS*LDYNFNIL 96 +Y F D DI L+HR+S + Y NI+ Sbjct: 54 FYGAHNFNYHDQDISLYHRLSITTKYYETNIV 85 >AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcriptase protein. Length = 1201 Score = 23.0 bits (47), Expect = 7.5 Identities = 12/28 (42%), Positives = 18/28 (64%), Gaps = 2/28 (7%) Frame = +3 Query: 168 GKQASRCPSRRLKWTR--QKPVKCALRS 245 G+Q RC SRR K T+ ++ + ALR+ Sbjct: 297 GRQHDRCDSRRWKTTQFNRQSFRVALRA 324 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 22.6 bits (46), Expect = 9.9 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +2 Query: 212 PPKAGEVRVKITATESAILTRIH 280 PPKAGEV + IT ++ H Sbjct: 1637 PPKAGEVLIFITELRVSVWLEGH 1659 >AY578809-1|AAT07314.1| 358|Anopheles gambiae Sloan-Kettering Institute proto-oncogeneproduct protein. Length = 358 Score = 22.6 bits (46), Expect = 9.9 Identities = 6/14 (42%), Positives = 11/14 (78%) Frame = -1 Query: 211 VHFNLLDGQRLACF 170 +H +L+G+R+ CF Sbjct: 114 LHMTMLEGKRIGCF 127 >AF364130-1|AAL35506.1| 417|Anopheles gambiae putative odorant receptor Or1 protein. Length = 417 Score = 22.6 bits (46), Expect = 9.9 Identities = 7/15 (46%), Positives = 12/15 (80%) Frame = +2 Query: 8 YLLNLSYRILIFCYI 52 YLL ++ ++ IFCY+ Sbjct: 324 YLLVMTSQVFIFCYV 338 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 553,951 Number of Sequences: 2352 Number of extensions: 10443 Number of successful extensions: 73 Number of sequences better than 10.0: 56 Number of HSP's better than 10.0 without gapping: 72 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 73 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 57609459 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -