BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0440.Seq (558 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_0141 + 23079516-23079925,23080006-23080084,23080204-230803... 29 2.5 02_04_0360 + 22353057-22353691,22354716-22355144,22355233-223553... 27 7.7 >04_04_0141 + 23079516-23079925,23080006-23080084,23080204-23080326, 23081655-23081771,23081886-23081945 Length = 262 Score = 29.1 bits (62), Expect = 2.5 Identities = 18/61 (29%), Positives = 28/61 (45%) Frame = +2 Query: 62 KNESTKRGTAITIFKCIHKLKTTQSHKVMQGLLKLMFPFVIPRSYHHGSRCRCLRNCFDY 241 K ES +T+ K T+ K+ G+LKL+ ++P S S+ L+ DY Sbjct: 76 KEESRGNEDRVTLIKDYRGKIETELTKICDGILKLLESHLVPSSTAPESKVFYLKMKGDY 135 Query: 242 Y 244 Y Sbjct: 136 Y 136 >02_04_0360 + 22353057-22353691,22354716-22355144,22355233-22355311, 22355472-22355594,22356256-22356372,22356636-22356833 Length = 526 Score = 27.5 bits (58), Expect = 7.7 Identities = 18/61 (29%), Positives = 27/61 (44%) Frame = +2 Query: 62 KNESTKRGTAITIFKCIHKLKTTQSHKVMQGLLKLMFPFVIPRSYHHGSRCRCLRNCFDY 241 K ES T+ K T+ K+ G+LKL+ ++P S S+ L+ DY Sbjct: 294 KEESRGNEDRCTLIKEYRGKIETELSKICDGILKLLDSHLVPSSTAPESKVFYLKMKGDY 353 Query: 242 Y 244 Y Sbjct: 354 Y 354 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,453,563 Number of Sequences: 37544 Number of extensions: 185049 Number of successful extensions: 438 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 428 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 438 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1269546012 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -