BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0439.Seq (548 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 21 6.2 AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein ... 21 6.2 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 21 8.2 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 21.4 bits (43), Expect = 6.2 Identities = 8/26 (30%), Positives = 16/26 (61%) Frame = -2 Query: 379 KSTMEDEKLKEKISDSDKQTILDKCN 302 + +++ EK+K +S +T+ KCN Sbjct: 331 RCSVKREKIKISVSYPSTETLNTKCN 356 >AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein protein. Length = 352 Score = 21.4 bits (43), Expect = 6.2 Identities = 11/41 (26%), Positives = 20/41 (48%) Frame = -1 Query: 323 DHPRQVQRHHQVAGFQPTGRQGGYEHKQKELEGICNPIITK 201 +HP Q Q+H+ A P Q + Q+ + C+P + + Sbjct: 19 EHPHQHQQHYGAAVQVPQQTQSVQQQSQQAGDP-CDPSLLR 58 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 21.0 bits (42), Expect = 8.2 Identities = 8/39 (20%), Positives = 19/39 (48%) Frame = -1 Query: 455 YRXEDDKQKETIQAKNALESYLLQHEVYHGG*EAQGKDL 339 + DD+++ ++ E+ H + HG +++ DL Sbjct: 58 FEGHDDREQPSVYPLLRFENPETHHPIRHGRRQSRSMDL 96 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 137,997 Number of Sequences: 438 Number of extensions: 3002 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15704448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -