BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0436.Seq (648 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY500851-1|AAS77205.1| 605|Anopheles gambiae G-protein coupled ... 24 3.6 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 24 4.8 U29486-1|AAC46995.1| 695|Anopheles gambiae ATP-binding-cassette... 23 8.3 U29485-1|AAC46994.1| 695|Anopheles gambiae ATP-binding-cassette... 23 8.3 U29484-1|AAC47423.1| 673|Anopheles gambiae ATP-binding-cassette... 23 8.3 >AY500851-1|AAS77205.1| 605|Anopheles gambiae G-protein coupled receptor 3 protein. Length = 605 Score = 24.2 bits (50), Expect = 3.6 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +2 Query: 419 WMKFIIFILLQDFGQ 463 W +IIF LLQ FGQ Sbjct: 467 WSPYIIFDLLQVFGQ 481 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 23.8 bits (49), Expect = 4.8 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +2 Query: 197 QKALSLTLFGSLFPSPVVDQH 259 Q ALS+T G LF P+ D H Sbjct: 845 QSALSITDLGQLFYRPLRDVH 865 >U29486-1|AAC46995.1| 695|Anopheles gambiae ATP-binding-cassette protein protein. Length = 695 Score = 23.0 bits (47), Expect = 8.3 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = +1 Query: 124 WFLNSNYISQ*SPWLSYQLWVIAYTESLVLNPIWFSI 234 +FLNS + +LSY W E+L++N W ++ Sbjct: 599 FFLNSASVPAYFKYLSYLSWFRYANEALLINQ-WSTV 634 >U29485-1|AAC46994.1| 695|Anopheles gambiae ATP-binding-cassette protein protein. Length = 695 Score = 23.0 bits (47), Expect = 8.3 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = +1 Query: 124 WFLNSNYISQ*SPWLSYQLWVIAYTESLVLNPIWFSI 234 +FLNS + +LSY W E+L++N W ++ Sbjct: 599 FFLNSASVPAYFKYLSYLSWFRYANEALLINQ-WSTV 634 >U29484-1|AAC47423.1| 673|Anopheles gambiae ATP-binding-cassette protein protein. Length = 673 Score = 23.0 bits (47), Expect = 8.3 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = +1 Query: 124 WFLNSNYISQ*SPWLSYQLWVIAYTESLVLNPIWFSI 234 +FLNS + +LSY W E+L++N W ++ Sbjct: 577 FFLNSASVPAYFKYLSYLSWFRYANEALLINQ-WSTV 612 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 704,844 Number of Sequences: 2352 Number of extensions: 15179 Number of successful extensions: 30 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 30 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 63977715 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -