BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0436.Seq (648 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY526236-1|AAS20469.1| 85|Apis mellifera epoxide hydrolase pro... 51 1e-08 >AY526236-1|AAS20469.1| 85|Apis mellifera epoxide hydrolase protein. Length = 85 Score = 50.8 bits (116), Expect = 1e-08 Identities = 22/56 (39%), Positives = 33/56 (58%), Gaps = 1/56 (1%) Frame = +2 Query: 98 QGGDWGAFIGSSIATIFPNEVLGYHTNFGLSLTQKALSLTLFGSLFPSPV-VDQHW 262 QGGDWG+ I S +A +FP +++G H N SL L G+ FPS + ++H+ Sbjct: 1 QGGDWGSVIASDMAVLFPEKIIGLHNNMCTSLNLSNLFWLFVGTYFPSLIGANEHY 56 Score = 30.3 bits (65), Expect = 0.017 Identities = 15/26 (57%), Positives = 18/26 (69%) Frame = +1 Query: 277 PLSGHIRDAIITEFGYMYIQATKPDT 354 P+S I +I E GY +IQATKPDT Sbjct: 61 PVS-EILSFLIEESGYFHIQATKPDT 85 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 193,063 Number of Sequences: 438 Number of extensions: 4598 Number of successful extensions: 6 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19560480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -