BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0434.Seq (598 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_1640 + 38836977-38836988,38837694-38838047,38838164-388382... 30 1.6 11_03_0025 + 9047646-9047958,9048150-9048474,9049833-9051828,905... 29 2.8 >01_06_1640 + 38836977-38836988,38837694-38838047,38838164-38838294, 38838554-38838860,38839036-38839349,38839507-38839645 Length = 418 Score = 29.9 bits (64), Expect = 1.6 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +3 Query: 159 WLSIIIHQRMFEQLLYCHLIICRHY 233 W + +H RM L CH+ +CRH+ Sbjct: 351 WQLLELHSRMCSALETCHVPLCRHF 375 >11_03_0025 + 9047646-9047958,9048150-9048474,9049833-9051828, 9051991-9052190,9052851-9052899 Length = 960 Score = 29.1 bits (62), Expect = 2.8 Identities = 11/32 (34%), Positives = 20/32 (62%), Gaps = 2/32 (6%) Frame = +2 Query: 422 CVFNVFVDLEVKGFFCFLFRWVDELTA--HLC 511 C F +L++K + C++ RW+ L++ HLC Sbjct: 691 CSLPKFHELDIKNYLCWVPRWITMLSSLVHLC 722 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,328,012 Number of Sequences: 37544 Number of extensions: 260857 Number of successful extensions: 415 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 411 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 415 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1423789920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -