BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0434.Seq (598 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC117325-1|AAI17326.1| 1221|Homo sapiens dermatan sulfate epimer... 30 5.4 AK021539-1|BAB13840.1| 755|Homo sapiens protein ( Homo sapiens ... 30 5.4 AF480435-1|AAN32895.1| 1222|Homo sapiens NCAG1 protein. 30 5.4 L40395-1|AAC42002.1| 346|Homo sapiens protein ( Homo sapiens (c... 29 9.5 BC011750-1|AAH11750.1| 351|Homo sapiens eukaryotic translation ... 29 9.5 BC003165-1|AAH03165.1| 351|Homo sapiens eukaryotic translation ... 29 9.5 BC000494-1|AAH00494.1| 351|Homo sapiens eukaryotic translation ... 29 9.5 AF035280-1|AAB88176.1| 351|Homo sapiens protein ( Homo sapiens ... 29 9.5 AC006530-5|AAD30183.1| 351|Homo sapiens EIF-2B protein. 29 9.5 >BC117325-1|AAI17326.1| 1221|Homo sapiens dermatan sulfate epimerase-like protein. Length = 1221 Score = 30.3 bits (65), Expect = 5.4 Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 1/55 (1%) Frame = +3 Query: 357 LQLQILKYDFNVYSEY*GWKMIVFLTFLLI*R*KAFFVSYLDGW-TSSQPTCVKW 518 + L IL + + Y + K++ ++ L+I +F+ LD W T SQP C KW Sbjct: 791 ISLVILTFQWRFYLSF--RKLMRWILILVI---ALWFIELLDVWSTCSQPICAKW 840 >AK021539-1|BAB13840.1| 755|Homo sapiens protein ( Homo sapiens cDNA FLJ11477 fis, clone HEMBA1001746, weakly similar to Homo sapiens squamous cell carcinoma antigen recognized by T ). Length = 755 Score = 30.3 bits (65), Expect = 5.4 Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 1/55 (1%) Frame = +3 Query: 357 LQLQILKYDFNVYSEY*GWKMIVFLTFLLI*R*KAFFVSYLDGW-TSSQPTCVKW 518 + L IL + + Y + K++ ++ L+I +F+ LD W T SQP C KW Sbjct: 576 ISLVILTFQWRFYLSF--RKLMRWILILVI---ALWFIELLDVWSTCSQPICAKW 625 >AF480435-1|AAN32895.1| 1222|Homo sapiens NCAG1 protein. Length = 1222 Score = 30.3 bits (65), Expect = 5.4 Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 1/55 (1%) Frame = +3 Query: 357 LQLQILKYDFNVYSEY*GWKMIVFLTFLLI*R*KAFFVSYLDGW-TSSQPTCVKW 518 + L IL + + Y + K++ ++ L+I +F+ LD W T SQP C KW Sbjct: 792 ISLVILTFQWRFYLSF--RKLMRWILILVI---ALWFIELLDVWSTCSQPICAKW 841 >L40395-1|AAC42002.1| 346|Homo sapiens protein ( Homo sapiens (clone S20iii15) mRNA, 3' end of cds. ). Length = 346 Score = 29.5 bits (63), Expect = 9.5 Identities = 10/31 (32%), Positives = 19/31 (61%) Frame = -3 Query: 275 IDTAAIDHTHTSEIIMSTNYQMTIEQLFKHS 183 I A++H H++E+IM+ + T+E K + Sbjct: 145 IAAQALEHIHSNEVIMTIGFSRTVEAFLKEA 175 >BC011750-1|AAH11750.1| 351|Homo sapiens eukaryotic translation initiation factor 2B, subunit 2 beta, 39kDa protein. Length = 351 Score = 29.5 bits (63), Expect = 9.5 Identities = 10/31 (32%), Positives = 19/31 (61%) Frame = -3 Query: 275 IDTAAIDHTHTSEIIMSTNYQMTIEQLFKHS 183 I A++H H++E+IM+ + T+E K + Sbjct: 151 IAAQALEHIHSNEVIMTIGFSRTVEAFLKEA 181 >BC003165-1|AAH03165.1| 351|Homo sapiens eukaryotic translation initiation factor 2B, subunit 2 beta, 39kDa protein. Length = 351 Score = 29.5 bits (63), Expect = 9.5 Identities = 10/31 (32%), Positives = 19/31 (61%) Frame = -3 Query: 275 IDTAAIDHTHTSEIIMSTNYQMTIEQLFKHS 183 I A++H H++E+IM+ + T+E K + Sbjct: 151 IAAQALEHIHSNEVIMTIGFSRTVEAFLKEA 181 >BC000494-1|AAH00494.1| 351|Homo sapiens eukaryotic translation initiation factor 2B, subunit 2 beta, 39kDa protein. Length = 351 Score = 29.5 bits (63), Expect = 9.5 Identities = 10/31 (32%), Positives = 19/31 (61%) Frame = -3 Query: 275 IDTAAIDHTHTSEIIMSTNYQMTIEQLFKHS 183 I A++H H++E+IM+ + T+E K + Sbjct: 151 IAAQALEHIHSNEVIMTIGFSRTVEAFLKEA 181 >AF035280-1|AAB88176.1| 351|Homo sapiens protein ( Homo sapiens clone 23689 mRNA, complete cds. ). Length = 351 Score = 29.5 bits (63), Expect = 9.5 Identities = 10/31 (32%), Positives = 19/31 (61%) Frame = -3 Query: 275 IDTAAIDHTHTSEIIMSTNYQMTIEQLFKHS 183 I A++H H++E+IM+ + T+E K + Sbjct: 151 IAAQALEHIHSNEVIMTIGFSRTVEAFLKEA 181 >AC006530-5|AAD30183.1| 351|Homo sapiens EIF-2B protein. Length = 351 Score = 29.5 bits (63), Expect = 9.5 Identities = 10/31 (32%), Positives = 19/31 (61%) Frame = -3 Query: 275 IDTAAIDHTHTSEIIMSTNYQMTIEQLFKHS 183 I A++H H++E+IM+ + T+E K + Sbjct: 151 IAAQALEHIHSNEVIMTIGFSRTVEAFLKEA 181 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 80,260,418 Number of Sequences: 237096 Number of extensions: 1545655 Number of successful extensions: 5693 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 5653 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5693 length of database: 76,859,062 effective HSP length: 86 effective length of database: 56,468,806 effective search space used: 6324506272 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -