BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0433.Seq (698 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY705399-1|AAU12508.1| 533|Anopheles gambiae nicotinic acetylch... 23 7.0 AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P... 23 9.2 >AY705399-1|AAU12508.1| 533|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 5 protein. Length = 533 Score = 23.4 bits (48), Expect = 7.0 Identities = 14/51 (27%), Positives = 24/51 (47%) Frame = -1 Query: 185 ICILLKAIYFVILKFLKYKGQGTILNVFKDHKENLYFLDKMCAVYCPFFVI 33 + ++LK I F+ + K + I KD K +D++C + FF I Sbjct: 470 LALILKEIRFITDQIRKEDEESDIA---KDWKFAAMVVDRLCLIIFTFFTI 517 >AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P450 reductase protein. Length = 679 Score = 23.0 bits (47), Expect = 9.2 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -3 Query: 639 YNTNDSRSNMSVATNYLAXK 580 Y T R N VAT +LA K Sbjct: 481 YETKTGRLNKGVATTFLAEK 500 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 673,628 Number of Sequences: 2352 Number of extensions: 11738 Number of successful extensions: 19 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71086350 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -