BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= msgV0433.Seq
(698 letters)
Database: bee
438 sequences; 146,343 total letters
Searching......................................................done
Score E
Sequences producing significant alignments: (bits) Value
DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related pro... 23 2.1
>DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related
protein STG-1 protein.
Length = 397
Score = 23.4 bits (48), Expect = 2.1
Identities = 8/30 (26%), Positives = 16/30 (53%)
Frame = -1
Query: 188 RICILLKAIYFVILKFLKYKGQGTILNVFK 99
R+C+ + + F++ L G ++VFK
Sbjct: 176 RLCVFVAGVVFIVSGLLMLVGMVMYISVFK 205
Database: bee
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 146,343
Number of sequences in database: 438
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 182,522
Number of Sequences: 438
Number of extensions: 3694
Number of successful extensions: 1
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 21439440
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -