BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0429.Seq (403 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value X52884-1|CAA37066.1| 461|Apis mellifera elongation factor 1 alp... 23 1.7 DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. 21 6.9 >X52884-1|CAA37066.1| 461|Apis mellifera elongation factor 1 alpha protein. Length = 461 Score = 22.6 bits (46), Expect = 1.7 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = -1 Query: 79 KKIGYNTISLYF 44 KKIGYNT S+ F Sbjct: 179 KKIGYNTASVAF 190 >DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. Length = 471 Score = 20.6 bits (41), Expect = 6.9 Identities = 11/30 (36%), Positives = 13/30 (43%) Frame = +1 Query: 97 YKLYTQYLQKHYYCIDLCTYVN*NKNPETL 186 YK T +QKH D C N + P L Sbjct: 312 YKYITPLIQKHLKIHDTCGVHNLHGMPGIL 341 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 75,568 Number of Sequences: 438 Number of extensions: 1104 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 10008927 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -