Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= msgV0429.Seq
         (403 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

X52884-1|CAA37066.1|  461|Apis mellifera elongation factor 1 alp...    23   1.7  
DQ011226-1|AAY63895.1|  471|Apis mellifera Rh-like protein protein.    21   6.9  

>X52884-1|CAA37066.1|  461|Apis mellifera elongation factor 1 alpha
           protein.
          Length = 461

 Score = 22.6 bits (46), Expect = 1.7
 Identities = 9/12 (75%), Positives = 10/12 (83%)
 Frame = -1

Query: 79  KKIGYNTISLYF 44
           KKIGYNT S+ F
Sbjct: 179 KKIGYNTASVAF 190


>DQ011226-1|AAY63895.1|  471|Apis mellifera Rh-like protein protein.
          Length = 471

 Score = 20.6 bits (41), Expect = 6.9
 Identities = 11/30 (36%), Positives = 13/30 (43%)
 Frame = +1

Query: 97  YKLYTQYLQKHYYCIDLCTYVN*NKNPETL 186
           YK  T  +QKH    D C   N +  P  L
Sbjct: 312 YKYITPLIQKHLKIHDTCGVHNLHGMPGIL 341


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 75,568
Number of Sequences: 438
Number of extensions: 1104
Number of successful extensions: 2
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2
length of database: 146,343
effective HSP length: 52
effective length of database: 123,567
effective search space used: 10008927
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.2 bits)