BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0427.Seq (402 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC26A3.01 |sxa1|SPAC2E1P5.06|aspartic protease Sxa1 |Schizosac... 27 1.4 SPAC12G12.09 |||sequence orphan|Schizosaccharomyces pombe|chr 1|... 25 3.3 >SPAC26A3.01 |sxa1|SPAC2E1P5.06|aspartic protease Sxa1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 533 Score = 26.6 bits (56), Expect = 1.4 Identities = 17/55 (30%), Positives = 27/55 (49%) Frame = +2 Query: 62 AKMFVYKIVFLNALSTYLKVLFSQLQLKNLIVVKNWYKKYSHSVASALMALSVLS 226 A FV+ I L AL + +S++ K +V+ + +Y H VA L VL+ Sbjct: 3 ASFFVFAISALQALQASVASAYSEVPGKRSVVLNLQHSQYDH-VARKLERTKVLN 56 >SPAC12G12.09 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 977 Score = 25.4 bits (53), Expect = 3.3 Identities = 17/48 (35%), Positives = 24/48 (50%) Frame = +2 Query: 92 LNALSTYLKVLFSQLQLKNLIVVKNWYKKYSHSVASALMALSVLSVYQ 235 LNA + +L++Q +KNL KN + K V AL L V + Q Sbjct: 282 LNANTDQSLILYTQSDVKNLHFGKNKHTKPHLLVMDALSNLYVWKILQ 329 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,522,140 Number of Sequences: 5004 Number of extensions: 26444 Number of successful extensions: 51 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 51 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 51 length of database: 2,362,478 effective HSP length: 66 effective length of database: 2,032,214 effective search space used: 136158338 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -