BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0424.Seq (400 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_01_0554 + 4856131-4856605,4858051-4858098,4860611-4860792,486... 29 1.0 05_05_0271 + 23733626-23733965,23734558-23735132,23736065-23736070 29 1.4 09_02_0088 + 4136698-4136857,4137530-4137558,4137992-4138954,413... 29 1.8 05_01_0372 - 2913518-2916562,2916674-2917528 28 3.1 03_05_0378 - 23619169-23619225,23619389-23619454,23620052-236202... 27 5.5 07_03_1567 - 27772815-27773302,27773471-27773561,27773641-277739... 27 7.2 07_03_1076 + 23779941-23779988,23780102-23780191,23781580-237816... 27 7.2 04_03_0870 + 20431215-20431419,20432559-20433439,20433829-204339... 27 7.2 06_03_0992 - 26680555-26680840,26680893-26681279,26681364-266824... 26 9.5 01_06_1127 - 34699119-34699360,34699446-34699689,34699773-346998... 26 9.5 >05_01_0554 + 4856131-4856605,4858051-4858098,4860611-4860792, 4861409-4863136 Length = 810 Score = 29.5 bits (63), Expect = 1.0 Identities = 13/41 (31%), Positives = 25/41 (60%) Frame = -1 Query: 226 EVKTDDKKSNKIETSGIIENVEREETIEPELSDTLSDAVPI 104 E + K++++E+ G+ NVE ++ E+++ S AVPI Sbjct: 426 EEAVEANKASRLESEGVEVNVELQKEEATEVNEARSQAVPI 466 >05_05_0271 + 23733626-23733965,23734558-23735132,23736065-23736070 Length = 306 Score = 29.1 bits (62), Expect = 1.4 Identities = 12/46 (26%), Positives = 26/46 (56%) Frame = -2 Query: 399 EANFSVGKNEKIDSDEQMIGIAANLQATEKDEVKTGDKESDKIETS 262 + F+VG + + ++G+AA + +++ K+G +E DK E + Sbjct: 78 QMGFAVGGGSVVVATASLVGLAATILCFKQNTDKSGAREEDKEEVT 123 >09_02_0088 + 4136698-4136857,4137530-4137558,4137992-4138954, 4138973-4139301,4139398-4139485,4139766-4139864, 4139935-4140245,4140532-4140685 Length = 710 Score = 28.7 bits (61), Expect = 1.8 Identities = 13/41 (31%), Positives = 25/41 (60%) Frame = -1 Query: 226 EVKTDDKKSNKIETSGIIENVEREETIEPELSDTLSDAVPI 104 E + K++++E+ G+ NVE ++ E+++ S AVPI Sbjct: 254 EEAVEANKASRLESEGVEVNVELQKEEAIEVNEARSQAVPI 294 >05_01_0372 - 2913518-2916562,2916674-2917528 Length = 1299 Score = 27.9 bits (59), Expect = 3.1 Identities = 11/44 (25%), Positives = 27/44 (61%) Frame = -1 Query: 253 ENVKREDTYEVKTDDKKSNKIETSGIIENVEREETIEPELSDTL 122 E+ ++E T + + + ++ S + E+ E+E+T+E E S+++ Sbjct: 306 ESTEKEQTVDDTSSEMIAHVSAESAVEESTEKEQTVESEASESV 349 >03_05_0378 - 23619169-23619225,23619389-23619454,23620052-23620224, 23620454-23620664,23621056-23621280,23622157-23622493, 23624200-23624627 Length = 498 Score = 27.1 bits (57), Expect = 5.5 Identities = 14/46 (30%), Positives = 28/46 (60%), Gaps = 1/46 (2%) Frame = -2 Query: 381 GKNEKIDS-DEQMIGIAANLQATEKDEVKTGDKESDKIETSGIERM 247 G++E I+S D + G+AA D+ + ++E ++ ET+G ++M Sbjct: 41 GRDEDIESEDSDLEGVAAAAAGGVGDDGEEEEEEEEEQETAGEKKM 86 >07_03_1567 - 27772815-27773302,27773471-27773561,27773641-27773988, 27774929-27775110,27775191-27775368,27775453-27775605, 27775993-27776232,27776369-27776449,27776485-27776730, 27777151-27777240,27777536-27777778,27778365-27778529, 27779017-27779080,27779162-27779286,27779383-27779476, 27779647-27779714,27779798-27779989,27780618-27780752, 27780847-27780934,27781014-27781107,27781484-27781547, 27781657-27781708,27781911-27782014,27782099-27782158, 27782687-27782770,27782892-27783125,27783442-27783864, 27784675-27784736,27784867-27785521 Length = 1700 Score = 26.6 bits (56), Expect = 7.2 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = -1 Query: 226 EVKTDDKKSNKIETSGIIENVEREETIE 143 E KTD++ K+E+ I E +ER E +E Sbjct: 1049 EDKTDEETKKKLESMDIDEILERAEKVE 1076 >07_03_1076 + 23779941-23779988,23780102-23780191,23781580-23781663, 23781792-23782010,23782873-23782974,23783809-23784207, 23784332-23784561,23784749-23784842,23784931-23785113, 23785254-23785351,23785831-23786143 Length = 619 Score = 26.6 bits (56), Expect = 7.2 Identities = 12/24 (50%), Positives = 17/24 (70%) Frame = -3 Query: 335 LLIYKQLKKTKLKQAIKNLIKSKL 264 LL+ K TKL++ I+ +IKSKL Sbjct: 425 LLLEVNTKTTKLREVIEKIIKSKL 448 >04_03_0870 + 20431215-20431419,20432559-20433439,20433829-20433990, 20434742-20435001,20435110-20435200,20435487-20435675 Length = 595 Score = 26.6 bits (56), Expect = 7.2 Identities = 11/38 (28%), Positives = 20/38 (52%) Frame = -1 Query: 154 ETIEPELSDTLSDAVPINVVDPITNNHINLKPDNFWIN 41 + +E + + T +D VP ++VD + +P WIN Sbjct: 31 DDLELQAAATTADGVPPSIVDSELRTGYHFQPPKNWIN 68 >06_03_0992 - 26680555-26680840,26680893-26681279,26681364-26682441, 26682537-26683083 Length = 765 Score = 26.2 bits (55), Expect = 9.5 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = -1 Query: 166 VEREETIEPELSDTLSDAVPINVVDPITNNHINLK 62 ++R+E I ++ + D P NVV IT+N N + Sbjct: 283 IKRKEYIAEKMIAVIEDVGPKNVVQVITDNAANCR 317 >01_06_1127 - 34699119-34699360,34699446-34699689,34699773-34699844, 34700123-34700218,34700322-34700438,34700520-34700676, 34700770-34700867,34700940-34701098,34701169-34701339, 34701402-34701479,34701548-34701667,34701968-34702085, 34702216-34702346,34702452-34702528,34702858-34702969, 34703057-34703239,34703416-34703517,34703617-34703718, 34703817-34703912,34704481-34704558,34704652-34704744, 34704817-34704938,34705035-34705116,34705204-34705278, 34705385-34705645,34705730-34705854,34705956-34706031, 34706128-34706277,34706359-34706454,34706707-34706814, 34706956-34707056,34707727-34707814,34707894-34708006, 34708278-34708383,34709143-34709247,34709356-34709427, 34709931-34709971,34710067-34710175,34710252-34710317, 34710404-34710540,34710788-34710890,34711416-34711535, 34711707-34711820,34711923-34712008,34712088-34712170, 34713283-34713347,34713444-34713621,34713697-34713776, 34714926-34715049,34715140-34715245,34715399-34715561 Length = 1966 Score = 26.2 bits (55), Expect = 9.5 Identities = 13/45 (28%), Positives = 21/45 (46%) Frame = -1 Query: 220 KTDDKKSNKIETSGIIENVEREETIEPELSDTLSDAVPINVVDPI 86 KTD +K + +IE+VE E E+ + LS V + + Sbjct: 565 KTDGGPQSKASAAPVIEDVEPSEMSLEEIEEKLSSVVKSETISQL 609 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,066,889 Number of Sequences: 37544 Number of extensions: 126755 Number of successful extensions: 423 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 412 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 423 length of database: 14,793,348 effective HSP length: 75 effective length of database: 11,977,548 effective search space used: 682720236 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -