BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0422.Seq (400 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_56793| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 4e-04 SB_1371| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 7e-04 SB_59794| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.037 SB_25244| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.037 SB_25694| Best HMM Match : RVT_1 (HMM E-Value=1.9e-22) 32 0.20 SB_15796| Best HMM Match : RVT_1 (HMM E-Value=0.00082) 32 0.20 SB_34518| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.4 SB_1817| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.2 SB_24480| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.6 SB_21457| Best HMM Match : efhand (HMM E-Value=1.7e-29) 27 7.4 SB_57268| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.8 SB_46519| Best HMM Match : DUF720 (HMM E-Value=0.49) 26 9.8 SB_42682| Best HMM Match : OmpA (HMM E-Value=0.72) 26 9.8 SB_9062| Best HMM Match : SAP (HMM E-Value=0.8) 26 9.8 SB_47155| Best HMM Match : PHD (HMM E-Value=1.5) 26 9.8 SB_29348| Best HMM Match : PHD (HMM E-Value=1.5) 26 9.8 SB_23149| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.8 SB_16760| Best HMM Match : OmpA (HMM E-Value=0.72) 26 9.8 SB_13321| Best HMM Match : PHD (HMM E-Value=1.5) 26 9.8 >SB_56793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 40.7 bits (91), Expect = 4e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +2 Query: 2 PVVICLSQRLSHACLSASRIKAIPRMA 82 PVVICLSQRLSHACLS S RMA Sbjct: 135 PVVICLSQRLSHACLSISTCTVKLRMA 161 >SB_1371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 39.9 bits (89), Expect = 7e-04 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +2 Query: 2 PVVICLSQRLSHACLSASRIKAIPRMA 82 PVVICLSQRLSHACLS S RMA Sbjct: 111 PVVICLSQRLSHACLSISTRTVKLRMA 137 >SB_59794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 34.3 bits (75), Expect = 0.037 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -3 Query: 398 APSPESNPDSPLPVTTM 348 APSPESNP+SP PV TM Sbjct: 112 APSPESNPNSPSPVVTM 128 >SB_25244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 212 Score = 34.3 bits (75), Expect = 0.037 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -3 Query: 398 APSPESNPDSPLPVTTM 348 APSPESNP+SP PV TM Sbjct: 56 APSPESNPNSPSPVVTM 72 >SB_25694| Best HMM Match : RVT_1 (HMM E-Value=1.9e-22) Length = 1797 Score = 31.9 bits (69), Expect = 0.20 Identities = 14/45 (31%), Positives = 25/45 (55%) Frame = +3 Query: 9 LYACLKD*AMHVSVQAVLRRYREWLNISVLVP*ILLSYLDNCGNS 143 L CL D A+ ++ + +Y W+N+ +LV L ++ CG+S Sbjct: 447 LMTCLYDKAVFLTDEEYAAKYGRWVNVQMLVEEPELHFIAKCGSS 491 >SB_15796| Best HMM Match : RVT_1 (HMM E-Value=0.00082) Length = 1304 Score = 31.9 bits (69), Expect = 0.20 Identities = 14/45 (31%), Positives = 25/45 (55%) Frame = +3 Query: 9 LYACLKD*AMHVSVQAVLRRYREWLNISVLVP*ILLSYLDNCGNS 143 L CL D A+ ++ + +Y W+N+ +LV L ++ CG+S Sbjct: 866 LMTCLYDKAVFLTDEEYAAKYGRWVNVQMLVEEPELHFIAKCGSS 910 >SB_34518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 337 Score = 28.3 bits (60), Expect = 2.4 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -1 Query: 400 RLPLRNRTLIPRYP 359 RLPLRNRTLI R+P Sbjct: 227 RLPLRNRTLILRHP 240 >SB_1817| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1300 Score = 27.9 bits (59), Expect = 3.2 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = +3 Query: 228 RPKSLILMNWITFADRMVKYRRRIFQM 308 R + + W TF DR +KY R +F++ Sbjct: 1005 RKEGAMKKRWFTFKDRQLKYYRGVFKV 1031 >SB_24480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 574 Score = 27.1 bits (57), Expect = 5.6 Identities = 14/39 (35%), Positives = 18/39 (46%) Frame = +1 Query: 67 DTANGSIYQFWFLRSYSVTWITVVILELIHAIRTLTSDG 183 D NG+I F + W + LE IH + TL DG Sbjct: 263 DFGNGTISSFTGNITRFNVWTLYISLEFIHNMATLVEDG 301 >SB_21457| Best HMM Match : efhand (HMM E-Value=1.7e-29) Length = 420 Score = 26.6 bits (56), Expect = 7.4 Identities = 21/65 (32%), Positives = 32/65 (49%), Gaps = 1/65 (1%) Frame = +1 Query: 28 IKPCMSQCKPY*GDTANGSIYQFWFLRSYSVTWITVVILELIHAIR-TLTSDGMSAFIRS 204 +KPC S P + +++ +VT+ V + IH R TL+SD M A S Sbjct: 35 LKPCSSNYAP---SEQSYNVFLAPLYTRATVTYKGPVQSQGIHLNRYTLSSDNMKANNIS 91 Query: 205 KPIDG 219 +P+DG Sbjct: 92 RPLDG 96 >SB_57268| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 912 Score = 26.2 bits (55), Expect = 9.8 Identities = 13/45 (28%), Positives = 24/45 (53%) Frame = +3 Query: 9 LYACLKD*AMHVSVQAVLRRYREWLNISVLVP*ILLSYLDNCGNS 143 L CL D A+ ++ + +Y +N+ +LV L ++ CG+S Sbjct: 512 LMTCLYDKAVFLTDEEYAAKYGRRVNVQMLVEEPELHFIAKCGSS 556 >SB_46519| Best HMM Match : DUF720 (HMM E-Value=0.49) Length = 1205 Score = 26.2 bits (55), Expect = 9.8 Identities = 13/45 (28%), Positives = 24/45 (53%) Frame = +3 Query: 9 LYACLKD*AMHVSVQAVLRRYREWLNISVLVP*ILLSYLDNCGNS 143 L CL D A+ ++ + +Y +N+ +LV L ++ CG+S Sbjct: 437 LMTCLYDKAVFLTDEEYAAKYGRRVNVQMLVEEPELHFIAKCGSS 481 >SB_42682| Best HMM Match : OmpA (HMM E-Value=0.72) Length = 296 Score = 26.2 bits (55), Expect = 9.8 Identities = 13/45 (28%), Positives = 24/45 (53%) Frame = +3 Query: 9 LYACLKD*AMHVSVQAVLRRYREWLNISVLVP*ILLSYLDNCGNS 143 L CL D A+ ++ + +Y +N+ +LV L ++ CG+S Sbjct: 221 LMTCLYDKAVFLTDEEYAAKYGRRVNVQMLVEEPELHFIAKCGSS 265 >SB_9062| Best HMM Match : SAP (HMM E-Value=0.8) Length = 293 Score = 26.2 bits (55), Expect = 9.8 Identities = 13/45 (28%), Positives = 24/45 (53%) Frame = +3 Query: 9 LYACLKD*AMHVSVQAVLRRYREWLNISVLVP*ILLSYLDNCGNS 143 L CL D A+ ++ + +Y +N+ +LV L ++ CG+S Sbjct: 107 LMTCLYDKAVFLTDEEYAAKYGRRVNVQMLVEEPELHFIAKCGSS 151 >SB_47155| Best HMM Match : PHD (HMM E-Value=1.5) Length = 285 Score = 26.2 bits (55), Expect = 9.8 Identities = 13/45 (28%), Positives = 24/45 (53%) Frame = +3 Query: 9 LYACLKD*AMHVSVQAVLRRYREWLNISVLVP*ILLSYLDNCGNS 143 L CL D A+ ++ + +Y +N+ +LV L ++ CG+S Sbjct: 107 LMTCLYDKAVFLTDEEYAAKYGRRVNVQMLVEEPELHFIAKCGSS 151 >SB_29348| Best HMM Match : PHD (HMM E-Value=1.5) Length = 212 Score = 26.2 bits (55), Expect = 9.8 Identities = 13/45 (28%), Positives = 24/45 (53%) Frame = +3 Query: 9 LYACLKD*AMHVSVQAVLRRYREWLNISVLVP*ILLSYLDNCGNS 143 L CL D A+ ++ + +Y +N+ +LV L ++ CG+S Sbjct: 32 LMTCLYDKAVFLTDEEYAAKYGRRVNVQMLVEEPELHFIAKCGSS 76 >SB_23149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 26.2 bits (55), Expect = 9.8 Identities = 13/45 (28%), Positives = 24/45 (53%) Frame = +3 Query: 9 LYACLKD*AMHVSVQAVLRRYREWLNISVLVP*ILLSYLDNCGNS 143 L CL D A+ ++ + +Y +N+ +LV L ++ CG+S Sbjct: 84 LMTCLYDKAVFLTDEEYAAKYGRRVNVQMLVEEPELHFIAKCGSS 128 >SB_16760| Best HMM Match : OmpA (HMM E-Value=0.72) Length = 933 Score = 26.2 bits (55), Expect = 9.8 Identities = 13/45 (28%), Positives = 24/45 (53%) Frame = +3 Query: 9 LYACLKD*AMHVSVQAVLRRYREWLNISVLVP*ILLSYLDNCGNS 143 L CL D A+ ++ + +Y +N+ +LV L ++ CG+S Sbjct: 519 LMTCLYDKAVFLTDEEYAAKYGRRVNVQMLVEEPELHFIAKCGSS 563 >SB_13321| Best HMM Match : PHD (HMM E-Value=1.5) Length = 249 Score = 26.2 bits (55), Expect = 9.8 Identities = 13/45 (28%), Positives = 24/45 (53%) Frame = +3 Query: 9 LYACLKD*AMHVSVQAVLRRYREWLNISVLVP*ILLSYLDNCGNS 143 L CL D A+ ++ + +Y +N+ +LV L ++ CG+S Sbjct: 84 LMTCLYDKAVFLTDEEYAAKYGRRVNVQMLVEEPELHFIAKCGSS 128 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,356,895 Number of Sequences: 59808 Number of extensions: 231148 Number of successful extensions: 569 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 516 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 569 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 703143849 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -