BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0419.Seq (359 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U41274-6|AAA82462.1| 601|Caenorhabditis elegans Hypothetical pr... 31 0.32 Z68118-2|CAA92188.2| 165|Caenorhabditis elegans Hypothetical pr... 30 0.56 >U41274-6|AAA82462.1| 601|Caenorhabditis elegans Hypothetical protein T04G9.6 protein. Length = 601 Score = 30.7 bits (66), Expect = 0.32 Identities = 18/57 (31%), Positives = 26/57 (45%) Frame = +2 Query: 137 TQSHKVMQGLLKLMFPFVIPRSYHHGSRCRCLRNCFGLLQNXXXXXXXFRSCRIPHC 307 ++ HK+ + L +FPF IPRSY + L+ CF LQ R +C Sbjct: 514 SRCHKITKDLSNSLFPFCIPRSYLCQHKMFTLK-CFFSLQTFCIKLTYLNLTRKKNC 569 >Z68118-2|CAA92188.2| 165|Caenorhabditis elegans Hypothetical protein R01E6.2 protein. Length = 165 Score = 29.9 bits (64), Expect = 0.56 Identities = 10/22 (45%), Positives = 17/22 (77%) Frame = +2 Query: 167 LKLMFPFVIPRSYHHGSRCRCL 232 L L+FPFV+P +Y++G+ C+ Sbjct: 8 LALLFPFVLPFNYNNGASAACI 29 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,615,101 Number of Sequences: 27780 Number of extensions: 109297 Number of successful extensions: 245 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 244 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 245 length of database: 12,740,198 effective HSP length: 73 effective length of database: 10,712,258 effective search space used: 492763868 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -