Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= msgV0419.Seq
         (359 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At2g39260.1 68415.m04821 MIF4G domain-containing protein similar...    26   6.6  

>At2g39260.1 68415.m04821 MIF4G domain-containing protein similar to
           hUPF2 [Homo sapiens] GI:12232320; contains Pfam profile
           PF02854: MIF4G domain
          Length = 1186

 Score = 26.2 bits (55), Expect = 6.6
 Identities = 14/39 (35%), Positives = 21/39 (53%)
 Frame = +2

Query: 68  AKNESTKRGTAITIFKCIHKLKTTQSHKVMQGLLKLMFP 184
           AK +S+    A+ I   +H+     S  + QGLLK+ FP
Sbjct: 101 AKLKSSDIQAAVQICSLLHQRYKEFSASLTQGLLKVFFP 139


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 6,059,590
Number of Sequences: 28952
Number of extensions: 95686
Number of successful extensions: 143
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 142
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 143
length of database: 12,070,560
effective HSP length: 72
effective length of database: 9,986,016
effective search space used: 469342752
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)