BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0418.Seq (403 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U40422-5|AAA81448.2| 494|Caenorhabditis elegans Hypothetical pr... 28 2.9 U13645-7|AAA20989.2| 598|Caenorhabditis elegans Hypothetical pr... 27 6.7 >U40422-5|AAA81448.2| 494|Caenorhabditis elegans Hypothetical protein T24D8.1 protein. Length = 494 Score = 27.9 bits (59), Expect = 2.9 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 178 RCKEYFWVIFLHFGLHYWSF 237 RC+ F +IFL F + YWSF Sbjct: 470 RCRIVFPMIFLLFNVAYWSF 489 >U13645-7|AAA20989.2| 598|Caenorhabditis elegans Hypothetical protein C05D10.3 protein. Length = 598 Score = 26.6 bits (56), Expect = 6.7 Identities = 15/52 (28%), Positives = 29/52 (55%) Frame = +3 Query: 81 TYAVATLFVNNNVFYKVLXHYFILSSIVFAGHAM*RIFLGNFFTLWVTLLEF 236 +YAVAT+F N +V +L F++ + F G + + ++F W++ L + Sbjct: 466 SYAVATIFANTDVAMTILP-IFVVPIMAFGGFFITFDAIPSYFK-WLSSLSY 515 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,145,357 Number of Sequences: 27780 Number of extensions: 145281 Number of successful extensions: 243 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 241 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 243 length of database: 12,740,198 effective HSP length: 74 effective length of database: 10,684,478 effective search space used: 630384202 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -