BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0415.Seq (404 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC2F3.11 |||exopolyphosphatase |Schizosaccharomyces pombe|chr ... 25 3.4 SPAC23G3.01 |rpb2|SPAC521.06|DNA-directed RNA polymerase II comp... 25 4.5 SPAC23G3.02c |sib1||ferrichrome synthetase Sib1|Schizosaccharomy... 25 5.9 SPAC4D7.07c |||sequence orphan|Schizosaccharomyces pombe|chr 1||... 24 7.8 >SPAC2F3.11 |||exopolyphosphatase |Schizosaccharomyces pombe|chr 1|||Manual Length = 384 Score = 25.4 bits (53), Expect = 3.4 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 6 SSIAYPYCLQRCPLAR 53 SSI Y YCLQR L R Sbjct: 46 SSIVYAYCLQRKQLGR 61 >SPAC23G3.01 |rpb2|SPAC521.06|DNA-directed RNA polymerase II complex subunit Rpb2|Schizosaccharomyces pombe|chr 1|||Manual Length = 1210 Score = 25.0 bits (52), Expect = 4.5 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = +2 Query: 2 SFEYCLSLLLTEVPSGPEEI*ALLCFNCFEEERS 103 S EY L E+P+G I A+LC++ + +E S Sbjct: 797 SMEY---LKFRELPAGQNAIVAILCYSGYNQEDS 827 >SPAC23G3.02c |sib1||ferrichrome synthetase Sib1|Schizosaccharomyces pombe|chr 1|||Manual Length = 4924 Score = 24.6 bits (51), Expect = 5.9 Identities = 12/47 (25%), Positives = 24/47 (51%) Frame = -1 Query: 251 DHLIHKRATLIITPVRMVATTLVRETVQFLTKRRQALPSTLIKIKYA 111 +++ A+LI+ + TT+ +Q + +LP+ L+ IK A Sbjct: 2661 NYIPQAHASLILDQFNAILTTIFNNPLQQIEILENSLPTQLLSIKPA 2707 >SPAC4D7.07c |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 600 Score = 24.2 bits (50), Expect = 7.8 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = -3 Query: 168 ISNKKKASSTIYADKDQIRAAND 100 +S K++ASS + D +Q+ AND Sbjct: 1 MSRKRQASSNDFFDMEQLLIAND 23 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,513,045 Number of Sequences: 5004 Number of extensions: 26727 Number of successful extensions: 71 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 70 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 71 length of database: 2,362,478 effective HSP length: 66 effective length of database: 2,032,214 effective search space used: 138190552 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -