BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0411.Seq (409 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF003139-2|AAB54165.1| 244|Caenorhabditis elegans Ribosomal pro... 38 0.003 AL132948-21|CAC51051.2| 453|Caenorhabditis elegans Hypothetical... 27 5.2 D49525-2|BAA08471.1| 567|Caenorhabditis elegans TPA-1B protein. 27 6.9 D49525-1|BAA08470.1| 704|Caenorhabditis elegans TPA-1A protein. 27 6.9 D14815-1|BAA03556.1| 557|Caenorhabditis elegans TPA-1 protein. 27 6.9 AF078781-3|AAC26917.1| 567|Caenorhabditis elegans Tpa (tetradec... 27 6.9 AF078781-2|AAC26916.1| 704|Caenorhabditis elegans Tpa (tetradec... 27 6.9 >AF003139-2|AAB54165.1| 244|Caenorhabditis elegans Ribosomal protein, large subunitprotein 7 protein. Length = 244 Score = 37.9 bits (84), Expect = 0.003 Identities = 23/61 (37%), Positives = 32/61 (52%) Frame = +3 Query: 96 SKKLPAVPESVLKHXXXXXXXXXXXLQVTLKRRSSAIKKKREIFKRAEQYVKETASRNVM 275 +KK+P VPE+VLK Q + + +KK + FKRAE+YV+E RN Sbjct: 4 TKKVPQVPETVLKRRKQRADARTKAAQHKVTVAAKNKEKKTQYFKRAEKYVQE--YRNAQ 61 Query: 276 K 278 K Sbjct: 62 K 62 >AL132948-21|CAC51051.2| 453|Caenorhabditis elegans Hypothetical protein Y39B6A.29 protein. Length = 453 Score = 27.1 bits (57), Expect = 5.2 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = -1 Query: 187 FSVTCNLLVRRASLLLRCLSTDSGTAGSFLLSSF 86 F TC+ L ++ L L L T GT+ SF LS F Sbjct: 238 FKQTCSALTSKSMLQLFPLFTVLGTSSSFWLSIF 271 >D49525-2|BAA08471.1| 567|Caenorhabditis elegans TPA-1B protein. Length = 567 Score = 26.6 bits (56), Expect = 6.9 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = +1 Query: 307 CQVVVI*SVLHQNDFTYRKFSVKEDLLAC 393 C++VV LH N+ YR + LL C Sbjct: 344 CEIVVALQFLHTNNIIYRDLKLDNVLLDC 372 >D49525-1|BAA08470.1| 704|Caenorhabditis elegans TPA-1A protein. Length = 704 Score = 26.6 bits (56), Expect = 6.9 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = +1 Query: 307 CQVVVI*SVLHQNDFTYRKFSVKEDLLAC 393 C++VV LH N+ YR + LL C Sbjct: 481 CEIVVALQFLHTNNIIYRDLKLDNVLLDC 509 >D14815-1|BAA03556.1| 557|Caenorhabditis elegans TPA-1 protein. Length = 557 Score = 26.6 bits (56), Expect = 6.9 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = +1 Query: 307 CQVVVI*SVLHQNDFTYRKFSVKEDLLAC 393 C++VV LH N+ YR + LL C Sbjct: 334 CEIVVALQFLHTNNIIYRDLKLDNVLLDC 362 >AF078781-3|AAC26917.1| 567|Caenorhabditis elegans Tpa (tetradecanoyl phorbol acetate)resistant protein 1, isoform b protein. Length = 567 Score = 26.6 bits (56), Expect = 6.9 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = +1 Query: 307 CQVVVI*SVLHQNDFTYRKFSVKEDLLAC 393 C++VV LH N+ YR + LL C Sbjct: 344 CEIVVALQFLHTNNIIYRDLKLDNVLLDC 372 >AF078781-2|AAC26916.1| 704|Caenorhabditis elegans Tpa (tetradecanoyl phorbol acetate)resistant protein 1, isoform a protein. Length = 704 Score = 26.6 bits (56), Expect = 6.9 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = +1 Query: 307 CQVVVI*SVLHQNDFTYRKFSVKEDLLAC 393 C++VV LH N+ YR + LL C Sbjct: 481 CEIVVALQFLHTNNIIYRDLKLDNVLLDC 509 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,871,025 Number of Sequences: 27780 Number of extensions: 107676 Number of successful extensions: 261 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 259 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 260 length of database: 12,740,198 effective HSP length: 74 effective length of database: 10,684,478 effective search space used: 651753158 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -