BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0407.Seq (411 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_01_0115 - 856957-858055,858479-858538,858802-859583 28 3.3 02_05_0151 - 26299042-26299207,26301678-26301851,26301926-263019... 27 5.8 >01_01_0115 - 856957-858055,858479-858538,858802-859583 Length = 646 Score = 27.9 bits (59), Expect = 3.3 Identities = 14/47 (29%), Positives = 28/47 (59%), Gaps = 3/47 (6%) Frame = -3 Query: 409 YNFSHALE*CVSDSFHCNSLNEGCRFS*QI---IETYFINVDIMIGT 278 Y +S ++ C++ SFHC + + GC + + ++ +FI V ++I T Sbjct: 246 YVYSSKIKQCIAQSFHCPT-DRGCNTTGHVDFEVDCWFILVPLVILT 291 >02_05_0151 - 26299042-26299207,26301678-26301851,26301926-26301987, 26302082-26302329,26303341-26303416,26303796-26303987, 26304109-26304225 Length = 344 Score = 27.1 bits (57), Expect = 5.8 Identities = 15/35 (42%), Positives = 19/35 (54%), Gaps = 1/35 (2%) Frame = -2 Query: 110 GMKYCLIKRN-ICF*EYKNVIGKKLYSCCILKQNE 9 G CL+ RN I F + VIG+K+ CC Q E Sbjct: 34 GFTTCLLGRNSILFGKTTVVIGEKVEHCCRWSQEE 68 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,548,816 Number of Sequences: 37544 Number of extensions: 176791 Number of successful extensions: 303 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 300 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 303 length of database: 14,793,348 effective HSP length: 75 effective length of database: 11,977,548 effective search space used: 730630428 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -