BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0405.Seq (408 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0584 - 9650996-9651488,9651630-9652049,9652129-9652158,965... 29 1.1 03_06_0307 + 33027012-33027167,33028505-33028615,33028927-330290... 28 2.5 02_05_0280 + 27435166-27435254,27436348-27436437,27436764-274368... 27 5.7 01_06_1128 - 34724469-34724699,34726103-34726213,34726301-347264... 27 7.6 01_01_0195 + 1697447-1697691,1698150-1698808,1699754-1701570,170... 27 7.6 >03_02_0584 - 9650996-9651488,9651630-9652049,9652129-9652158, 9652201-9652287,9652657-9653669,9653832-9654854, 9654946-9654969 Length = 1029 Score = 29.5 bits (63), Expect = 1.1 Identities = 14/45 (31%), Positives = 22/45 (48%) Frame = -2 Query: 362 TRDNHGSRRNYHRKLIRQTFERCVAGT*PCDLQKLSDSSKLTTSD 228 T D+ GS RN ++ T + C T D+Q +SD ++ D Sbjct: 586 TSDSMGSGRNLQKEHDSNTHQNCSFVTNKIDMQGISDDKRINVKD 630 >03_06_0307 + 33027012-33027167,33028505-33028615,33028927-33029065, 33029215-33029323,33029422-33029425 Length = 172 Score = 28.3 bits (60), Expect = 2.5 Identities = 12/32 (37%), Positives = 23/32 (71%) Frame = +2 Query: 212 RRRASRPKSLILMNRITFADRMVKYRRRIFQM 307 R+RA+ K++ L N+I +R+++ RR+I +M Sbjct: 28 RKRAAAAKTVSLKNQIRSTERLLRKRRKIERM 59 >02_05_0280 + 27435166-27435254,27436348-27436437,27436764-27436866, 27437318-27437377,27437745-27439148,27439227-27439328, 27439424-27439609,27439695-27439820,27439905-27440000, 27440509-27440574 Length = 773 Score = 27.1 bits (57), Expect = 5.7 Identities = 11/24 (45%), Positives = 19/24 (79%) Frame = +2 Query: 149 NTCNQNSDQ*WDECFY*IKTNRRR 220 N+ N++SDQ +C+Y +KTNR++ Sbjct: 741 NSLNRSSDQ-ISKCYYSLKTNRKQ 763 >01_06_1128 - 34724469-34724699,34726103-34726213,34726301-34726409, 34726517-34726581,34726661-34726838,34726918-34726997, 34727838-34727961,34728064-34728172,34728299-34728461 Length = 389 Score = 26.6 bits (56), Expect = 7.6 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +3 Query: 99 FLRSYSVTWITVVILELIHAIRTLTSDGMSAF 194 F+R Y TW + +L+ + TLT S F Sbjct: 241 FIRCYDCTWTLIDEYDLVDPVHTLTPPEESGF 272 >01_01_0195 + 1697447-1697691,1698150-1698808,1699754-1701570, 1701700-1701771 Length = 930 Score = 26.6 bits (56), Expect = 7.6 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = +1 Query: 238 VNFDESDNFCRSHGQVPATHL 300 ++ +E+ NFC ++P THL Sbjct: 447 IDMNEASNFCTGKCEIPTTHL 467 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,806,184 Number of Sequences: 37544 Number of extensions: 202519 Number of successful extensions: 458 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 449 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 458 length of database: 14,793,348 effective HSP length: 75 effective length of database: 11,977,548 effective search space used: 718652880 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -