BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0405.Seq (408 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ986315-1|ABK59975.1| 504|Anopheles gambiae catalase protein. 23 4.3 DQ980210-1|ABL09378.1| 504|Anopheles gambiae catalase protein. 23 4.3 DQ980209-1|ABL09377.1| 504|Anopheles gambiae catalase protein. 23 4.3 DQ980208-1|ABL09376.1| 504|Anopheles gambiae catalase protein. 23 4.3 DQ980207-1|ABL09375.1| 504|Anopheles gambiae catalase protein. 23 4.3 DQ980206-1|ABL09374.1| 504|Anopheles gambiae catalase protein. 23 4.3 DQ980205-1|ABL09373.1| 504|Anopheles gambiae catalase protein. 23 4.3 DQ980204-1|ABL09372.1| 504|Anopheles gambiae catalase protein. 23 4.3 DQ980203-1|ABL09371.1| 504|Anopheles gambiae catalase protein. 23 4.3 DQ980202-1|ABL09370.1| 504|Anopheles gambiae catalase protein. 23 4.3 DQ980201-1|ABL09369.1| 504|Anopheles gambiae catalase protein. 23 4.3 DQ980200-1|ABL09368.1| 504|Anopheles gambiae catalase protein. 23 4.3 DQ980199-1|ABL09367.1| 504|Anopheles gambiae catalase protein. 23 4.3 AY505416-1|AAR90327.1| 485|Anopheles gambiae catalase 1 protein. 23 4.3 AB097148-1|BAC82627.1| 357|Anopheles gambiae gag-like protein p... 22 7.5 AY705405-1|AAU12514.1| 519|Anopheles gambiae nicotinic acetylch... 22 9.9 AY705398-1|AAU12507.1| 555|Anopheles gambiae nicotinic acetylch... 22 9.9 AY705397-1|AAU12506.1| 555|Anopheles gambiae nicotinic acetylch... 22 9.9 >DQ986315-1|ABK59975.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 4.3 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -3 Query: 307 HLKDASPVLDHAICKSY 257 HLKDASP L K++ Sbjct: 465 HLKDASPFLQERAVKNF 481 >DQ980210-1|ABL09378.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 4.3 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -3 Query: 307 HLKDASPVLDHAICKSY 257 HLKDASP L K++ Sbjct: 465 HLKDASPFLQERAVKNF 481 >DQ980209-1|ABL09377.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 4.3 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -3 Query: 307 HLKDASPVLDHAICKSY 257 HLKDASP L K++ Sbjct: 465 HLKDASPFLQERAVKNF 481 >DQ980208-1|ABL09376.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 4.3 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -3 Query: 307 HLKDASPVLDHAICKSY 257 HLKDASP L K++ Sbjct: 465 HLKDASPFLQERAVKNF 481 >DQ980207-1|ABL09375.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 4.3 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -3 Query: 307 HLKDASPVLDHAICKSY 257 HLKDASP L K++ Sbjct: 465 HLKDASPFLQERAVKNF 481 >DQ980206-1|ABL09374.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 4.3 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -3 Query: 307 HLKDASPVLDHAICKSY 257 HLKDASP L K++ Sbjct: 465 HLKDASPFLQERAVKNF 481 >DQ980205-1|ABL09373.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 4.3 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -3 Query: 307 HLKDASPVLDHAICKSY 257 HLKDASP L K++ Sbjct: 465 HLKDASPFLQERAVKNF 481 >DQ980204-1|ABL09372.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 4.3 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -3 Query: 307 HLKDASPVLDHAICKSY 257 HLKDASP L K++ Sbjct: 465 HLKDASPFLQERAVKNF 481 >DQ980203-1|ABL09371.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 4.3 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -3 Query: 307 HLKDASPVLDHAICKSY 257 HLKDASP L K++ Sbjct: 465 HLKDASPFLQERAVKNF 481 >DQ980202-1|ABL09370.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 4.3 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -3 Query: 307 HLKDASPVLDHAICKSY 257 HLKDASP L K++ Sbjct: 465 HLKDASPFLQERAVKNF 481 >DQ980201-1|ABL09369.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 4.3 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -3 Query: 307 HLKDASPVLDHAICKSY 257 HLKDASP L K++ Sbjct: 465 HLKDASPFLQERAVKNF 481 >DQ980200-1|ABL09368.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 4.3 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -3 Query: 307 HLKDASPVLDHAICKSY 257 HLKDASP L K++ Sbjct: 465 HLKDASPFLQERAVKNF 481 >DQ980199-1|ABL09367.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 4.3 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -3 Query: 307 HLKDASPVLDHAICKSY 257 HLKDASP L K++ Sbjct: 465 HLKDASPFLQERAVKNF 481 >AY505416-1|AAR90327.1| 485|Anopheles gambiae catalase 1 protein. Length = 485 Score = 23.0 bits (47), Expect = 4.3 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -3 Query: 307 HLKDASPVLDHAICKSY 257 HLKDASP L K++ Sbjct: 449 HLKDASPFLQERAVKNF 465 >AB097148-1|BAC82627.1| 357|Anopheles gambiae gag-like protein protein. Length = 357 Score = 22.2 bits (45), Expect = 7.5 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = -3 Query: 406 VSQAPSPESNPDSPLPVTTMVVAETTIES 320 V AP P + D P VT E+ +ES Sbjct: 298 VLPAPFPGPSTDEPRTVTRKRTTESDVES 326 >AY705405-1|AAU12514.1| 519|Anopheles gambiae nicotinic acetylcholine receptor subunitbeta 1 protein. Length = 519 Score = 21.8 bits (44), Expect = 9.9 Identities = 13/48 (27%), Positives = 24/48 (50%) Frame = -3 Query: 223 GPPSIGFDLIKALIPSLVRVLIACISSRITTVIQVTE*DLRNQN*YIE 80 G IG D + S +L++ +S+ T ++ LRN++ YI+ Sbjct: 418 GDLGIGADSCRRESESSDSILLSPEASKATEAVEFIAEHLRNEDLYIQ 465 >AY705398-1|AAU12507.1| 555|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 4 protein. Length = 555 Score = 21.8 bits (44), Expect = 9.9 Identities = 7/38 (18%), Positives = 21/38 (55%) Frame = +2 Query: 11 YACLKD*AMHVSVQAVLRRYREWLNISVLVP*ILLSYL 124 Y C + + ++ +RR + +++++P + +S+L Sbjct: 223 YTCCDEPYLDITFNITMRRKTLFYTVNIIIPCMGISFL 260 >AY705397-1|AAU12506.1| 555|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 4 protein. Length = 555 Score = 21.8 bits (44), Expect = 9.9 Identities = 7/38 (18%), Positives = 21/38 (55%) Frame = +2 Query: 11 YACLKD*AMHVSVQAVLRRYREWLNISVLVP*ILLSYL 124 Y C + + ++ +RR + +++++P + +S+L Sbjct: 223 YTCCDEPYLDITFNITMRRKTLFYTVNIIIPCMGISFL 260 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 420,744 Number of Sequences: 2352 Number of extensions: 8026 Number of successful extensions: 26 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 32922351 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -