BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0405.Seq (408 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 23 1.8 AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic ac... 22 2.3 DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholi... 22 3.1 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 22 3.1 Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP... 21 4.1 DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholi... 21 5.4 DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channe... 21 7.1 X16709-1|CAA34681.1| 162|Apis mellifera phospholipase A-2 protein. 20 9.4 EF373554-1|ABQ28728.1| 167|Apis mellifera phospholipase A2 prot... 20 9.4 DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholi... 20 9.4 AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein ... 20 9.4 AF438408-1|AAL30844.1| 167|Apis mellifera phospholipase A2 prot... 20 9.4 AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. 20 9.4 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 22.6 bits (46), Expect = 1.8 Identities = 15/45 (33%), Positives = 20/45 (44%) Frame = +3 Query: 39 MSQCKPY*GDTANGSIYQFWFLRSYSVTWITVVILELIHAIRTLT 173 M C P DT +Y+F R Y + T VI + + TLT Sbjct: 230 MYACCP--NDTYPMIVYEFSISRHYGILHATYVIPAVTMMLLTLT 272 >AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic acetylcholine receptorApisa2 subunit protein. Length = 541 Score = 22.2 bits (45), Expect = 2.3 Identities = 10/38 (26%), Positives = 19/38 (50%) Frame = +2 Query: 11 YACLKD*AMHVSVQAVLRRYREWLNISVLVP*ILLSYL 124 Y C + + LRR + ++++VP + +SYL Sbjct: 215 YPCCDEPYPDIFFNITLRRKTLFYTVNLIVPCVSISYL 252 >DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 21.8 bits (44), Expect = 3.1 Identities = 7/38 (18%), Positives = 21/38 (55%) Frame = +2 Query: 11 YACLKD*AMHVSVQAVLRRYREWLNISVLVP*ILLSYL 124 Y C + + ++ +RR + +++++P + +S+L Sbjct: 224 YTCCDEPYLDITFNITMRRKTLFYTVNIIIPCMGISFL 261 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 21.8 bits (44), Expect = 3.1 Identities = 7/38 (18%), Positives = 21/38 (55%) Frame = +2 Query: 11 YACLKD*AMHVSVQAVLRRYREWLNISVLVP*ILLSYL 124 Y C + + ++ +RR + +++++P + +S+L Sbjct: 224 YTCCDEPYLDITFNITMRRKTLFYTVNIIIPCMGISFL 261 >Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP57-2 protein. Length = 464 Score = 21.4 bits (43), Expect = 4.1 Identities = 10/25 (40%), Positives = 11/25 (44%) Frame = +1 Query: 229 SEVVNFDESDNFCRSHGQVPATHLS 303 S NFD DN +H A H S Sbjct: 412 SRCANFDNQDNNHYNHNHNQARHSS 436 >DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholine receptor alpha3subunit protein. Length = 566 Score = 21.0 bits (42), Expect = 5.4 Identities = 7/38 (18%), Positives = 21/38 (55%) Frame = +2 Query: 11 YACLKD*AMHVSVQAVLRRYREWLNISVLVP*ILLSYL 124 Y C + + ++ +RR + +++++P + +S+L Sbjct: 220 YTCCDEPYLDITFNITMRRKTLFYTVNLIIPCMGISFL 257 >DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channel protein. Length = 489 Score = 20.6 bits (41), Expect = 7.1 Identities = 9/36 (25%), Positives = 22/36 (61%) Frame = -3 Query: 253 IHQN*RLRTRGPPSIGFDLIKALIPSLVRVLIACIS 146 I+Q L + +IG+ + + +PS++ V+++ +S Sbjct: 227 IYQRLSLSFKLQRNIGYFVFQTYLPSILIVMLSWVS 262 >X16709-1|CAA34681.1| 162|Apis mellifera phospholipase A-2 protein. Length = 162 Score = 20.2 bits (40), Expect = 9.4 Identities = 8/23 (34%), Positives = 13/23 (56%) Frame = +3 Query: 45 QCKPY*GDTANGSIYQFWFLRSY 113 +C Y D + +YQ++ LR Y Sbjct: 140 RCLHYTVDKSKPKVYQWFDLRKY 162 >EF373554-1|ABQ28728.1| 167|Apis mellifera phospholipase A2 protein. Length = 167 Score = 20.2 bits (40), Expect = 9.4 Identities = 8/23 (34%), Positives = 13/23 (56%) Frame = +3 Query: 45 QCKPY*GDTANGSIYQFWFLRSY 113 +C Y D + +YQ++ LR Y Sbjct: 145 RCLHYTVDKSKPKVYQWFDLRKY 167 >DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholine receptor alpha1subunit protein. Length = 601 Score = 20.2 bits (40), Expect = 9.4 Identities = 8/38 (21%), Positives = 20/38 (52%) Frame = +2 Query: 11 YACLKD*AMHVSVQAVLRRYREWLNISVLVP*ILLSYL 124 Y C ++ + LRR + +++++P + +S+L Sbjct: 216 YICCEEPYPDIVFNITLRRKTLFYTVNLIIPCVGISFL 253 >AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein 1 protein. Length = 500 Score = 20.2 bits (40), Expect = 9.4 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = -3 Query: 388 PESNPDSPLP 359 P SNP SP+P Sbjct: 438 PSSNPVSPVP 447 >AF438408-1|AAL30844.1| 167|Apis mellifera phospholipase A2 protein. Length = 167 Score = 20.2 bits (40), Expect = 9.4 Identities = 8/23 (34%), Positives = 13/23 (56%) Frame = +3 Query: 45 QCKPY*GDTANGSIYQFWFLRSY 113 +C Y D + +YQ++ LR Y Sbjct: 145 RCLHYTVDKSKPKVYQWFDLRKY 167 >AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. Length = 493 Score = 20.2 bits (40), Expect = 9.4 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 134 GNSRANTCN 160 GNSRANT N Sbjct: 131 GNSRANTYN 139 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 111,288 Number of Sequences: 438 Number of extensions: 2010 Number of successful extensions: 13 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 10256061 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -