BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0403.Seq (409 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglu... 21 3.5 AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 ... 21 4.6 DQ855491-1|ABH88178.1| 144|Tribolium castaneum chemosensory pro... 20 8.1 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 20 8.1 >EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglucosaminidase NAG2 protein. Length = 593 Score = 21.4 bits (43), Expect = 3.5 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = +3 Query: 105 LNLMILKLTSREITSNIPESLSRVTV 182 ++ + L+ + E T+N PE + VTV Sbjct: 111 ISWIFLETVANENTTNCPEQKNTVTV 136 >AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 protein protein. Length = 301 Score = 21.0 bits (42), Expect = 4.6 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +2 Query: 38 DDDLFPGFSDT 70 D +LFPGF T Sbjct: 13 DSELFPGFGST 23 >DQ855491-1|ABH88178.1| 144|Tribolium castaneum chemosensory protein 5 protein. Length = 144 Score = 20.2 bits (40), Expect = 8.1 Identities = 7/17 (41%), Positives = 10/17 (58%) Frame = -2 Query: 282 IFVFHDLFFAAFPSFVN 232 + +F +FF F FVN Sbjct: 5 VILFFGVFFIIFSDFVN 21 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 20.2 bits (40), Expect = 8.1 Identities = 8/39 (20%), Positives = 21/39 (53%) Frame = +3 Query: 42 TICSRDFQIRSRCQRYQR*SLLNLMILKLTSREITSNIP 158 ++ SRD +R+ +Y +++ +++ + + NIP Sbjct: 109 SVHSRDVNVRAVVNQYYEAEVVSEYVIRGNTAVLKCNIP 147 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 81,779 Number of Sequences: 336 Number of extensions: 1382 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 51 effective length of database: 105,449 effective search space used: 8857716 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -