BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0403.Seq (409 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 25 0.33 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 24 0.76 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 24 0.76 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 25.0 bits (52), Expect = 0.33 Identities = 13/30 (43%), Positives = 20/30 (66%), Gaps = 2/30 (6%) Frame = +2 Query: 80 PEIP-EIKSLEFDDIKTHVA-GDNEQYTGE 163 PEI E++ +E+DDIKT ++ G N+ E Sbjct: 290 PEIKKEVEDMEYDDIKTELSTGMNDDIPPE 319 Score = 22.2 bits (45), Expect = 2.3 Identities = 12/31 (38%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Frame = +3 Query: 261 KGHGIQRW-RLNKSSDYSRIKKFKSKILFHK 350 KG+G+ W + SD SR+ +K L HK Sbjct: 478 KGNGVYAWIGAGRDSD-SRLLDLCTKFLMHK 507 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 23.8 bits (49), Expect = 0.76 Identities = 12/41 (29%), Positives = 21/41 (51%) Frame = +2 Query: 2 ITIASAGFVWEDDDDLFPGFSDTFKMPEIPEIKSLEFDDIK 124 I++A FV + ++ PG D PE+ E + + D +K Sbjct: 1856 ISVAETTFVGGNQGNVVPGNGDRSDRPELSEAE-CDIDSLK 1895 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 23.8 bits (49), Expect = 0.76 Identities = 12/41 (29%), Positives = 21/41 (51%) Frame = +2 Query: 2 ITIASAGFVWEDDDDLFPGFSDTFKMPEIPEIKSLEFDDIK 124 I++A FV + ++ PG D PE+ E + + D +K Sbjct: 1852 ISVAETTFVGGNQGNVVPGNGDRSDRPELSEAE-CDIDSLK 1891 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 97,250 Number of Sequences: 438 Number of extensions: 1710 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 10256061 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -