BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0402.Seq (349 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_01_0067 + 578828-579176,579429-579505,579850-579954 26 7.1 09_05_0007 - 20036981-20037159,20037690-20037943,20038103-200383... 26 9.3 >12_01_0067 + 578828-579176,579429-579505,579850-579954 Length = 176 Score = 26.2 bits (55), Expect = 7.1 Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 8/40 (20%) Frame = -1 Query: 112 IIYNSVKN*ERCATL--------ELNEICTCYLTIYENKS 17 +I N V+N CA + +L E+ TCY+TIY ++ Sbjct: 105 VISNKVENTSPCANMVSVLDYLGKLRELRTCYVTIYAQRA 144 >09_05_0007 - 20036981-20037159,20037690-20037943,20038103-20038355, 20038447-20038640,20039122-20039252,20039378-20039488, 20039834-20039932 Length = 406 Score = 25.8 bits (54), Expect = 9.3 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = -1 Query: 79 CATLELNEICTCYLTIYENKSLAFL 5 CA + N +C+CY + ENK +A + Sbjct: 349 CADVP-NGVCSCYGVVQENKRIAHI 372 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,876,885 Number of Sequences: 37544 Number of extensions: 77897 Number of successful extensions: 99 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 99 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 99 length of database: 14,793,348 effective HSP length: 73 effective length of database: 12,052,636 effective search space used: 506210712 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -