BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0401.Seq (408 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase ... 21 5.4 AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. 21 5.4 DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 20 9.4 DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. 20 9.4 DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. 20 9.4 AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 20 9.4 >AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase protein. Length = 510 Score = 21.0 bits (42), Expect = 5.4 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +2 Query: 86 ELFRRSLSTLRPSFTVKY 139 E FRR +ST+ F V+Y Sbjct: 451 EKFRRWVSTMSRPFEVRY 468 >AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. Length = 615 Score = 21.0 bits (42), Expect = 5.4 Identities = 9/23 (39%), Positives = 15/23 (65%) Frame = -2 Query: 260 SVSRHGLRHSSSLGSYVPFTIRA 192 ++SR+G+R SS+ PF R+ Sbjct: 255 TISRNGVRLSSARAFITPFENRS 277 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 20.2 bits (40), Expect = 9.4 Identities = 7/10 (70%), Positives = 9/10 (90%) Frame = +1 Query: 28 HAEAMASLPP 57 HA++ ASLPP Sbjct: 291 HAKSQASLPP 300 >DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. Length = 552 Score = 20.2 bits (40), Expect = 9.4 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -2 Query: 305 SDGSILYRPS*LFFFSVSRHGLRHSSSLGSYVP 207 S GS++ R +FF V+R + + Y+P Sbjct: 436 SSGSVIDRNGVMFFNMVTRDSVWCWDTRKEYIP 468 >DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. Length = 471 Score = 20.2 bits (40), Expect = 9.4 Identities = 6/19 (31%), Positives = 11/19 (57%) Frame = -1 Query: 255 LTPWVETFIIIRFICAIHN 199 +TP ++ + I C +HN Sbjct: 315 ITPLIQKHLKIHDTCGVHN 333 >AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 20.2 bits (40), Expect = 9.4 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = +2 Query: 95 RRSLSTLRPSFTVKYMHSNANMKNF 169 R S + S + K +H+N N KN+ Sbjct: 308 RSKESKIISSLSNKTIHNNNNYKNY 332 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 108,838 Number of Sequences: 438 Number of extensions: 2074 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 10256061 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -