BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0400.Seq (406 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ535204-1|CAD59404.1| 1187|Anopheles gambiae SMC2 protein protein. 23 4.2 AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcript... 23 5.6 >AJ535204-1|CAD59404.1| 1187|Anopheles gambiae SMC2 protein protein. Length = 1187 Score = 23.0 bits (47), Expect = 4.2 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = -3 Query: 194 GEGMXEGEFSEAREDLSALEKDYEE 120 G+G E E A EDL +K EE Sbjct: 781 GKGHRERELKSAEEDLKRSKKKSEE 805 >AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcriptase protein. Length = 1022 Score = 22.6 bits (46), Expect = 5.6 Identities = 12/37 (32%), Positives = 17/37 (45%) Frame = +3 Query: 135 LEGRQVLTGFGELSLLHTLTDXPVHESTLGVHEVELV 245 L+ ++ T EL H +TD P H+ T E V Sbjct: 365 LDPEKLNTIIDELFPSHPVTDWPTHQPTTSQENPESV 401 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 377,210 Number of Sequences: 2352 Number of extensions: 5892 Number of successful extensions: 15 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 32494788 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -