BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0399.Seq (396 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_22017| Best HMM Match : 7tm_1 (HMM E-Value=1.8e-08) 29 1.0 SB_44547| Best HMM Match : 7tm_1 (HMM E-Value=7.9e-11) 26 9.6 >SB_22017| Best HMM Match : 7tm_1 (HMM E-Value=1.8e-08) Length = 338 Score = 29.5 bits (63), Expect = 1.0 Identities = 18/60 (30%), Positives = 29/60 (48%), Gaps = 1/60 (1%) Frame = -3 Query: 250 AYFIKLYTSMLHEQI*FKFSTMSFNFSLCFYI*LNKAI*TVYTCNVNY-PCFCFNSVFYF 74 A+ +L ++ LHE++ +K +S L FY+ + V C +N P C N F F Sbjct: 244 AWMRRLTSNSLHERVNYKVFKISLAIVLAFYLCYSCYWLQVTLCTLNEPPRLCANQTFRF 303 >SB_44547| Best HMM Match : 7tm_1 (HMM E-Value=7.9e-11) Length = 332 Score = 26.2 bits (55), Expect = 9.6 Identities = 10/17 (58%), Positives = 14/17 (82%) Frame = -1 Query: 132 RYTLVMLTTRVFVLILY 82 +Y LVM TRVF+L+L+ Sbjct: 140 KYQLVMTRTRVFILLLF 156 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,287,695 Number of Sequences: 59808 Number of extensions: 154798 Number of successful extensions: 284 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 269 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 283 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 690807992 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -