BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0394.Seq (409 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_P07856 Cluster: Sericin 1 precursor; n=4; Bombyx mori|R... 48 7e-05 UniRef50_Q8AXX1 Cluster: Putative gag protein; n=1; Danio rerio|... 33 2.9 >UniRef50_P07856 Cluster: Sericin 1 precursor; n=4; Bombyx mori|Rep: Sericin 1 precursor - Bombyx mori (Silk moth) Length = 1186 Score = 48.0 bits (109), Expect = 7e-05 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = +2 Query: 287 EDGFWWWXXRKSXSXHKXATXXHSQXDXTST 379 EDGFWWW RKS S HK AT S D TST Sbjct: 1075 EDGFWWWNRRKSGSGHKSATVQSSTTDKTST 1105 >UniRef50_Q8AXX1 Cluster: Putative gag protein; n=1; Danio rerio|Rep: Putative gag protein - Danio rerio (Zebrafish) (Brachydanio rerio) Length = 612 Score = 32.7 bits (71), Expect = 2.9 Identities = 18/46 (39%), Positives = 24/46 (52%) Frame = +1 Query: 97 RPLAXPVTLMXAPXKNPPRALXAALKDIVXVAXMEAXHPPTVPXQV 234 +PL+ P TL P NPP +L AL + +A PTVP Q+ Sbjct: 283 QPLSNPFTLSSIPPYNPPPSLHQAL---THSSSTDAAQHPTVPSQI 325 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 242,222,800 Number of Sequences: 1657284 Number of extensions: 2788227 Number of successful extensions: 3826 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3723 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3823 length of database: 575,637,011 effective HSP length: 92 effective length of database: 423,166,883 effective search space used: 18196175969 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -