BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0393.Seq (409 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ370036-1|ABD18597.1| 103|Anopheles gambiae putative TIL domai... 36 6e-04 DQ370042-1|ABD18603.1| 194|Anopheles gambiae putative TIL domai... 29 0.065 DQ370047-1|ABD18608.1| 89|Anopheles gambiae putative secreted ... 28 0.15 DQ370046-1|ABD18607.1| 125|Anopheles gambiae putative secreted ... 28 0.15 DQ370045-1|ABD18606.1| 285|Anopheles gambiae putative TIL domai... 27 0.26 DQ370041-1|ABD18602.1| 85|Anopheles gambiae putative salivary ... 27 0.35 DQ370040-1|ABD18601.1| 121|Anopheles gambiae putative TIL domai... 27 0.35 AF117748-1|AAD38334.1| 365|Anopheles gambiae serine protease 14... 26 0.61 DQ370044-1|ABD18605.1| 99|Anopheles gambiae putative salivary ... 25 0.80 AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr... 24 2.5 AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 23 3.2 DQ370038-1|ABD18599.1| 122|Anopheles gambiae putative TIL domai... 23 4.3 CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. 23 4.3 AY578797-1|AAT07302.1| 304|Anopheles gambiae activin protein. 23 4.3 EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calc... 22 9.9 CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos... 22 9.9 >DQ370036-1|ABD18597.1| 103|Anopheles gambiae putative TIL domain protein protein. Length = 103 Score = 35.9 bits (79), Expect = 6e-04 Identities = 15/40 (37%), Positives = 22/40 (55%) Frame = -1 Query: 409 TRGEVICDIPNPCLSGCVCNSYYKHRSVSDNQCIPAKECP 290 ++ E D N C++GC C Y R++ CI AK+CP Sbjct: 56 SKPEPDADCTNVCVAGCFCKKNYVRRAIG-GSCIWAKKCP 94 >DQ370042-1|ABD18603.1| 194|Anopheles gambiae putative TIL domain polypeptide protein. Length = 194 Score = 29.1 bits (62), Expect = 0.065 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = -1 Query: 373 CLSGCVCNSYYKHRSVSDNQCIPAKECP 290 C GC C Y RS CIP CP Sbjct: 168 CTEGCFCKPSYI-RSSDGGPCIPTNNCP 194 >DQ370047-1|ABD18608.1| 89|Anopheles gambiae putative secreted peptide protein. Length = 89 Score = 27.9 bits (59), Expect = 0.15 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = -1 Query: 376 PCLSGCVCNSYYKHRSVSDNQCIPAKECPPV 284 P C C YK R ++ +CI A +C PV Sbjct: 50 PMKDFCACRIGYK-RDLTSGKCIAADQCTPV 79 >DQ370046-1|ABD18607.1| 125|Anopheles gambiae putative secreted polypeptide protein. Length = 125 Score = 27.9 bits (59), Expect = 0.15 Identities = 11/25 (44%), Positives = 14/25 (56%), Gaps = 3/25 (12%) Frame = -1 Query: 334 RSVSDNQCIPAKECPP---VKCTRP 269 R + +C+P KECPP KC P Sbjct: 42 REQPEQRCVPTKECPPDEVFKCCGP 66 >DQ370045-1|ABD18606.1| 285|Anopheles gambiae putative TIL domain protein protein. Length = 285 Score = 27.1 bits (57), Expect = 0.26 Identities = 11/31 (35%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = -3 Query: 164 CVCDENHFRNND-GVCVPAEECPSYVINTEH 75 CVC + R + G C+P CP I + H Sbjct: 95 CVCKKGFVRKTEFGKCIPLRLCPRISIASAH 125 >DQ370041-1|ABD18602.1| 85|Anopheles gambiae putative salivary secreted peptide withTIL domain protein. Length = 85 Score = 26.6 bits (56), Expect = 0.35 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = -3 Query: 167 RCVCDENHFRNNDGVCVPAEEC 102 +C C + RN +G CV A C Sbjct: 60 KCFCKDGFLRNENGKCVRAWHC 81 >DQ370040-1|ABD18601.1| 121|Anopheles gambiae putative TIL domain polypeptide protein. Length = 121 Score = 26.6 bits (56), Expect = 0.35 Identities = 10/25 (40%), Positives = 12/25 (48%) Frame = -3 Query: 170 PRCVCDENHFRNNDGVCVPAEECPS 96 P C C + RN CVP+ C S Sbjct: 95 PGCFCRGGYVRNKSNRCVPSYMCQS 119 >AF117748-1|AAD38334.1| 365|Anopheles gambiae serine protease 14A protein. Length = 365 Score = 25.8 bits (54), Expect = 0.61 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -3 Query: 137 NNDGVCVPAEECPS 96 + DGVC P ++CPS Sbjct: 31 HRDGVCHPVQQCPS 44 >DQ370044-1|ABD18605.1| 99|Anopheles gambiae putative salivary secreted peptide withTIL domain protein. Length = 99 Score = 25.4 bits (53), Expect = 0.80 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = -1 Query: 373 CLSGCVCNSYYKHRSVSDNQCIPAKEC 293 C+SGC C Y R DN C+ C Sbjct: 56 CVSGCFCRPGYFRR--EDNACVKPWLC 80 Score = 23.0 bits (47), Expect = 4.3 Identities = 8/21 (38%), Positives = 9/21 (42%) Frame = -3 Query: 164 CVCDENHFRNNDGVCVPAEEC 102 C C +FR D CV C Sbjct: 60 CFCRPGYFRREDNACVKPWLC 80 >AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 precursor protein. Length = 1623 Score = 23.8 bits (49), Expect = 2.5 Identities = 9/19 (47%), Positives = 10/19 (52%), Gaps = 1/19 (5%) Frame = -3 Query: 170 PRCV-CDENHFRNNDGVCV 117 P C C EN F DG C+ Sbjct: 377 PNCERCKENFFMREDGYCI 395 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 23.4 bits (48), Expect = 3.2 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +2 Query: 206 DCPHRCSSRIGTSMDKIPDF 265 + P+ CS R+GT + DF Sbjct: 1393 EVPNTCSDRLGTPKTSLMDF 1412 >DQ370038-1|ABD18599.1| 122|Anopheles gambiae putative TIL domain polypeptide protein. Length = 122 Score = 23.0 bits (47), Expect = 4.3 Identities = 7/23 (30%), Positives = 10/23 (43%) Frame = -1 Query: 361 CVCNSYYKHRSVSDNQCIPAKEC 293 C+C Y D +CI + C Sbjct: 87 CICGEEYDREYKDDEKCILPEHC 109 >CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. Length = 1664 Score = 23.0 bits (47), Expect = 4.3 Identities = 15/43 (34%), Positives = 20/43 (46%) Frame = -2 Query: 402 ARSFATYQTLAFLDVFVTPTISTEASVTINVSPPKSVHRSSAP 274 ARS Q L F+D TP+ S A+ + P V S +P Sbjct: 909 ARSTPKKQNLKFIDEASTPSTSAMAATIV----PNPVQASPSP 947 >AY578797-1|AAT07302.1| 304|Anopheles gambiae activin protein. Length = 304 Score = 23.0 bits (47), Expect = 4.3 Identities = 10/31 (32%), Positives = 19/31 (61%) Frame = +1 Query: 73 QCSVLMT*EGHSSAGTHTPSLFLK*FSSHTQ 165 +CS + + E ++ + P +FL+ FS HT+ Sbjct: 4 RCSKIRSYEVNNISPISPPPVFLQEFSKHTE 34 >EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calcium channel alpha2-delta subunit 1 protein. Length = 1256 Score = 21.8 bits (44), Expect = 9.9 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = -2 Query: 258 GILSIDVPIRELQR 217 G++ DVPI E+Q+ Sbjct: 511 GVVGTDVPIEEIQK 524 >CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon polyprotein protein. Length = 1726 Score = 21.8 bits (44), Expect = 9.9 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = -3 Query: 161 VCDENHFRNNDGVCVPAEECPSYVINTEH*WKTNGICKNC 42 +C+E H + VC E VIN E + +G+C NC Sbjct: 346 LCNEQHPLH---VCERFERAS--VINREEIVRKHGLCFNC 380 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 447,560 Number of Sequences: 2352 Number of extensions: 9687 Number of successful extensions: 31 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 31 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 32922351 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -