BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0391.Seq (398 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1783.01 |||FAD binding protein|Schizosaccharomyces pombe|chr... 25 5.7 SPAC3A11.07 |||NADH dehydrogenase|Schizosaccharomyces pombe|chr ... 24 7.6 >SPAC1783.01 |||FAD binding protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 583 Score = 24.6 bits (51), Expect = 5.7 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = +3 Query: 3 YFCFKLYFEHVNIFSSSERYEQITSSFSIY 92 Y CF YF ++ SS Y+++ S +Y Sbjct: 19 YKCFVKYFPKCSVQSSFHSYDELAFSRRLY 48 >SPAC3A11.07 |||NADH dehydrogenase|Schizosaccharomyces pombe|chr 1|||Manual Length = 551 Score = 24.2 bits (50), Expect = 7.6 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = -3 Query: 297 YFWNYIYIHKXVSVRLITSIT 235 YFW +Y+ + S+R T++T Sbjct: 515 YFWRSVYLSELYSLRNRTNVT 535 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,418,280 Number of Sequences: 5004 Number of extensions: 22162 Number of successful extensions: 59 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 58 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 59 length of database: 2,362,478 effective HSP length: 66 effective length of database: 2,032,214 effective search space used: 134126124 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -