BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0391.Seq (398 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U53341-7|AAC69111.3| 744|Caenorhabditis elegans Hypothetical pr... 27 6.5 AF125956-4|AAD14723.1| 353|Caenorhabditis elegans Serpentine re... 27 6.5 AF067622-5|AAC17544.1| 371|Caenorhabditis elegans Nuclear hormo... 27 6.5 >U53341-7|AAC69111.3| 744|Caenorhabditis elegans Hypothetical protein F49E10.1 protein. Length = 744 Score = 26.6 bits (56), Expect = 6.5 Identities = 11/37 (29%), Positives = 19/37 (51%) Frame = +3 Query: 3 YFCFKLYFEHVNIFSSSERYEQITSSFSIYTRNILTL 113 YFCFK + + S+ + E + + Y RN+L + Sbjct: 555 YFCFKNFMQQTVFSSTPQGNENLMETNLTYLRNMLRM 591 >AF125956-4|AAD14723.1| 353|Caenorhabditis elegans Serpentine receptor, class h protein78 protein. Length = 353 Score = 26.6 bits (56), Expect = 6.5 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = +2 Query: 20 LFRTCKYF*FLRTLRTNYFVVFNLHKKYFNFNK 118 L R F + L+ NYFV++ ++ +F+ NK Sbjct: 211 LGRIMNVFFVIEILQINYFVIYCIYNLFFSSNK 243 >AF067622-5|AAC17544.1| 371|Caenorhabditis elegans Nuclear hormone receptor familyprotein 15 protein. Length = 371 Score = 26.6 bits (56), Expect = 6.5 Identities = 15/57 (26%), Positives = 27/57 (47%), Gaps = 2/57 (3%) Frame = -3 Query: 345 RVSFHNKFWDHCPS*RYFWNYIYIHKXV-SVRLITSITTRIRYI-PSNIVTRYLNKL 181 R+++H K+WD C + F N K + R + ++YI P + LN++ Sbjct: 64 RITYHCKYWDRCYDGQEFVNVKKFSKRCRACRYQRCLQVGMKYICPGKLELELLNRV 120 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,790,934 Number of Sequences: 27780 Number of extensions: 120183 Number of successful extensions: 251 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 248 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 251 length of database: 12,740,198 effective HSP length: 74 effective length of database: 10,684,478 effective search space used: 619699724 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -