BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0388.Seq (412 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A0BQD0 Cluster: Chromosome undetermined scaffold_120, w... 32 5.2 >UniRef50_A0BQD0 Cluster: Chromosome undetermined scaffold_120, whole genome shotgun sequence; n=3; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_120, whole genome shotgun sequence - Paramecium tetraurelia Length = 609 Score = 31.9 bits (69), Expect = 5.2 Identities = 16/57 (28%), Positives = 28/57 (49%) Frame = -1 Query: 307 KQIHIDFIKLSCSYINERTSRVLKHNIEEQ*NNLRPFRNHVLKVYYVLGRSVLYLFW 137 K+ I F+ S++++ T ++L H E+ N FRN + G+ + LFW Sbjct: 519 KRDPIHFLLYDASFLHQMTKKLLSHVFEKWNKNFITFRNATKEEREKQGKKGIALFW 575 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 289,286,418 Number of Sequences: 1657284 Number of extensions: 4300686 Number of successful extensions: 7498 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 7394 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7497 length of database: 575,637,011 effective HSP length: 92 effective length of database: 423,166,883 effective search space used: 18619342852 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -