BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0388.Seq (412 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT022919-1|AAY55335.1| 376|Drosophila melanogaster IP11254p pro... 28 4.2 BT022400-1|AAY54816.1| 378|Drosophila melanogaster IP11554p pro... 28 4.2 BT022300-1|AAY54716.1| 378|Drosophila melanogaster IP11354p pro... 28 4.2 BT022248-1|AAY54664.1| 378|Drosophila melanogaster IP11454p pro... 28 4.2 AE014134-1298|AAF52530.1| 397|Drosophila melanogaster CG6717-PA... 28 4.2 >BT022919-1|AAY55335.1| 376|Drosophila melanogaster IP11254p protein. Length = 376 Score = 28.3 bits (60), Expect = 4.2 Identities = 12/38 (31%), Positives = 18/38 (47%) Frame = +1 Query: 142 INTKRNDLVRSILLKHDFEKDASYFIALQYYALAPWKY 255 I + ++R+I+L DF D S F+ Y W Y Sbjct: 140 ILNRTRGMIRNIVLPKDFNSDTSAFLVNAIYFKGQWLY 177 >BT022400-1|AAY54816.1| 378|Drosophila melanogaster IP11554p protein. Length = 378 Score = 28.3 bits (60), Expect = 4.2 Identities = 12/38 (31%), Positives = 18/38 (47%) Frame = +1 Query: 142 INTKRNDLVRSILLKHDFEKDASYFIALQYYALAPWKY 255 I + ++R+I+L DF D S F+ Y W Y Sbjct: 142 ILNRTRGMIRNIVLPKDFNSDTSAFLVNAIYFKGQWLY 179 >BT022300-1|AAY54716.1| 378|Drosophila melanogaster IP11354p protein. Length = 378 Score = 28.3 bits (60), Expect = 4.2 Identities = 12/38 (31%), Positives = 18/38 (47%) Frame = +1 Query: 142 INTKRNDLVRSILLKHDFEKDASYFIALQYYALAPWKY 255 I + ++R+I+L DF D S F+ Y W Y Sbjct: 142 ILNRTRGMIRNIVLPKDFNSDTSAFLVNAIYFKGQWLY 179 >BT022248-1|AAY54664.1| 378|Drosophila melanogaster IP11454p protein. Length = 378 Score = 28.3 bits (60), Expect = 4.2 Identities = 12/38 (31%), Positives = 18/38 (47%) Frame = +1 Query: 142 INTKRNDLVRSILLKHDFEKDASYFIALQYYALAPWKY 255 I + ++R+I+L DF D S F+ Y W Y Sbjct: 142 ILNRTRGMIRNIVLPKDFNSDTSAFLVNAIYFKGQWLY 179 >AE014134-1298|AAF52530.1| 397|Drosophila melanogaster CG6717-PA protein. Length = 397 Score = 28.3 bits (60), Expect = 4.2 Identities = 12/38 (31%), Positives = 18/38 (47%) Frame = +1 Query: 142 INTKRNDLVRSILLKHDFEKDASYFIALQYYALAPWKY 255 I + ++R+I+L DF D S F+ Y W Y Sbjct: 161 ILNRTRGMIRNIVLPKDFNSDTSAFLVNAIYFKGQWLY 198 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,643,276 Number of Sequences: 53049 Number of extensions: 188373 Number of successful extensions: 280 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 280 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 280 length of database: 24,988,368 effective HSP length: 78 effective length of database: 20,850,546 effective search space used: 1209331668 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -