BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0387.Seq (410 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 129 8e-31 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 128 1e-30 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 128 1e-30 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 128 1e-30 SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 5e-24 SB_37427| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 1e-22 SB_26118| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 1e-22 SB_57017| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 1e-22 SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-22 SB_27498| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 2e-22 SB_18570| Best HMM Match : Moricin (HMM E-Value=6.5) 100 5e-22 SB_48986| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 7e-22 SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_2468| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 2e-21 SB_14754| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 2e-21 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 98 3e-21 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 98 3e-21 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 98 3e-21 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 98 3e-21 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 98 3e-21 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 98 3e-21 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 98 3e-21 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 98 3e-21 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 98 3e-21 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) 98 3e-21 SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 98 3e-21 SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) 98 3e-21 SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 98 3e-21 SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) 98 3e-21 SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) 98 3e-21 SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) 98 3e-21 SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) 98 3e-21 SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) 98 3e-21 SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) 98 3e-21 SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) 98 3e-21 SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) 98 3e-21 SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) 98 3e-21 SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_21247| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_19461| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_18289| Best HMM Match : IgG_binding_B (HMM E-Value=7) 98 3e-21 SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05) 98 3e-21 SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_15493| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_15295| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) 98 3e-21 SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_12962| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_12873| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_12187| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_11632| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_10031| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_9450| Best HMM Match : CM_1 (HMM E-Value=3.1) 98 3e-21 SB_8714| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_8621| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_8582| Best HMM Match : CsgG (HMM E-Value=4.9e-06) 98 3e-21 SB_8530| Best HMM Match : ThiC (HMM E-Value=2.7e-07) 98 3e-21 SB_8498| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_6842| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_5521| Best HMM Match : SWIM (HMM E-Value=6.9) 98 3e-21 SB_5457| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_3676| Best HMM Match : Cuticle_2 (HMM E-Value=3.2) 98 3e-21 SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5) 98 3e-21 SB_55779| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) 98 3e-21 SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_53532| Best HMM Match : IgG_binding_B (HMM E-Value=7.8) 98 3e-21 SB_52081| Best HMM Match : DUF1634 (HMM E-Value=0.55) 98 3e-21 SB_51949| Best HMM Match : Toxin_14 (HMM E-Value=0.051) 98 3e-21 SB_49112| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08) 98 3e-21 SB_48358| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_45065| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) 98 3e-21 SB_43660| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_43339| Best HMM Match : SAC3_GANP (HMM E-Value=1.8e-09) 98 3e-21 SB_42664| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_41564| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_41244| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092) 98 3e-21 SB_35835| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_31775| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_30891| Best HMM Match : LIM (HMM E-Value=4.40008e-43) 98 3e-21 SB_30664| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_29747| Best HMM Match : Ank (HMM E-Value=0) 98 3e-21 SB_28552| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_27244| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_26386| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_25785| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_22440| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_20758| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_19831| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_19310| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_12047| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_11928| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_11382| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_8032| Best HMM Match : IBB (HMM E-Value=0.46) 98 3e-21 SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) 98 3e-21 SB_7742| Best HMM Match : HEAT (HMM E-Value=9e-23) 98 3e-21 SB_7402| Best HMM Match : Extensin_2 (HMM E-Value=2) 98 3e-21 SB_5394| Best HMM Match : PEGSRP (HMM E-Value=1.5) 98 3e-21 SB_372| Best HMM Match : CBM_2 (HMM E-Value=0.00043) 98 3e-21 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 4e-21 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 4e-21 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 4e-21 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 4e-21 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 4e-21 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 4e-21 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 4e-21 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 4e-21 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 4e-21 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 4e-21 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 4e-21 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 4e-21 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 4e-21 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 97 4e-21 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 4e-21 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 4e-21 SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 4e-21 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 4e-21 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 4e-21 SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 4e-21 SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 4e-21 SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 4e-21 SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 4e-21 SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 4e-21 SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 4e-21 SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 4e-21 SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 4e-21 SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 4e-21 SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 4e-21 SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 4e-21 SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 4e-21 SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 4e-21 SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 4e-21 SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 4e-21 SB_24181| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 4e-21 SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6) 97 4e-21 SB_22468| Best HMM Match : CUT (HMM E-Value=6.8) 97 4e-21 SB_20839| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 4e-21 SB_20747| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 4e-21 SB_16725| Best HMM Match : DAGAT (HMM E-Value=1e-39) 97 4e-21 SB_15150| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 4e-21 SB_15134| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 4e-21 SB_15127| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 4e-21 SB_14862| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 4e-21 SB_13372| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 4e-21 SB_12726| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 4e-21 SB_12236| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 4e-21 SB_11249| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 4e-21 SB_10911| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 4e-21 SB_10687| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 4e-21 SB_10456| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 4e-21 SB_9697| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 4e-21 SB_8806| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 4e-21 SB_7973| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 4e-21 SB_7142| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 4e-21 SB_6464| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 4e-21 SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 4e-21 SB_6070| Best HMM Match : PEGSRP (HMM E-Value=3.8) 97 4e-21 SB_4705| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 4e-21 SB_4191| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 4e-21 SB_3728| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 4e-21 SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 4e-21 SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 4e-21 SB_55925| Best HMM Match : Homeobox (HMM E-Value=1e-26) 97 4e-21 SB_55030| Best HMM Match : Toxin_27 (HMM E-Value=1.2) 97 4e-21 SB_54425| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 4e-21 SB_51954| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 4e-21 SB_51253| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 4e-21 SB_46185| Best HMM Match : Flt3_lig (HMM E-Value=3.3) 97 4e-21 SB_45537| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 4e-21 SB_42518| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 4e-21 SB_39279| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 4e-21 SB_36908| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 4e-21 SB_34678| Best HMM Match : Bromodomain (HMM E-Value=9e-25) 97 4e-21 SB_34602| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 4e-21 SB_32133| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 4e-21 SB_31269| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 4e-21 SB_27230| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 4e-21 SB_20620| Best HMM Match : zf-HIT (HMM E-Value=8.5e-10) 97 4e-21 SB_20378| Best HMM Match : Adeno_E1B_19K (HMM E-Value=5.7) 97 4e-21 SB_20169| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 4e-21 SB_19077| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 4e-21 SB_15849| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 4e-21 SB_12231| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 4e-21 SB_11962| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 4e-21 SB_11225| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 4e-21 SB_9128| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 4e-21 SB_6875| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 4e-21 SB_2918| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 4e-21 SB_1078| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 4e-21 SB_44936| Best HMM Match : UCR_TM (HMM E-Value=7.2) 97 5e-21 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 7e-21 SB_8453| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 7e-21 SB_8727| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 7e-21 SB_18436| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 9e-21 SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) 96 1e-20 SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 96 1e-20 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 96 1e-20 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 96 1e-20 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 96 1e-20 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 96 1e-20 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_56189| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 96 1e-20 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) 96 1e-20 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) 96 1e-20 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 96 1e-20 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 96 1e-20 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 96 1e-20 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 96 1e-20 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) 96 1e-20 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 96 1e-20 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 96 1e-20 SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) 96 1e-20 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 96 1e-20 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) 96 1e-20 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 96 1e-20 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 96 1e-20 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) 96 1e-20 SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) 96 1e-20 SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 96 1e-20 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 96 1e-20 SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) 96 1e-20 SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 96 1e-20 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) 96 1e-20 SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 96 1e-20 SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_43701| Best HMM Match : ubiquitin (HMM E-Value=0.003) 96 1e-20 SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) 96 1e-20 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) 96 1e-20 SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 96 1e-20 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 96 1e-20 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5) 96 1e-20 SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_41779| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_41365| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) 96 1e-20 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_40471| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_40265| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_40240| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_40230| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_40107| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_39438| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_39406| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_39107| Best HMM Match : Lyase_8 (HMM E-Value=0.016) 96 1e-20 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_38893| Best HMM Match : UMPH-1 (HMM E-Value=2.3e-21) 96 1e-20 SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 96 1e-20 SB_38726| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 96 1e-20 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) 96 1e-20 SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_37372| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_37038| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 1e-20 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 129 bits (312), Expect = 8e-31 Identities = 56/59 (94%), Positives = 57/59 (96%) Frame = -3 Query: 213 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSRHDVVKRRPVNCNTTHYRANW 37 +LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF HDVVKRRPVNCNTTHYRANW Sbjct: 22 QLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFPSHDVVKRRPVNCNTTHYRANW 80 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 128 bits (310), Expect = 1e-30 Identities = 58/63 (92%), Positives = 58/63 (92%) Frame = -3 Query: 225 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSRHDVVKRRPVNCNTTHYR 46 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSW GF HDVVKRRPVNCNTTHYR Sbjct: 589 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSW---GFPSHDVVKRRPVNCNTTHYR 645 Query: 45 ANW 37 ANW Sbjct: 646 ANW 648 Score = 28.7 bits (61), Expect = 2.0 Identities = 29/71 (40%), Positives = 34/71 (47%) Frame = +2 Query: 2 IDTVDLEGGPGTQFAL**VVLQFTGRRFTTS*RENPGVTQLNRLAAHPPFASWRNSEEAR 181 IDTVDLEGGP V L+ T TT N + + A+H PF RN E R Sbjct: 553 IDTVDLEGGPALASVA--VTLRVT----TTPAALNAPL----QGASHSPF-RLRNCWEGR 601 Query: 182 TDRPSQQLRSL 214 + R S LR L Sbjct: 602 SVRASSLLRQL 612 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 128 bits (310), Expect = 1e-30 Identities = 58/63 (92%), Positives = 58/63 (92%) Frame = -3 Query: 225 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSRHDVVKRRPVNCNTTHYR 46 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSW GF HDVVKRRPVNCNTTHYR Sbjct: 32 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSW---GFPSHDVVKRRPVNCNTTHYR 88 Query: 45 ANW 37 ANW Sbjct: 89 ANW 91 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 128 bits (310), Expect = 1e-30 Identities = 58/63 (92%), Positives = 58/63 (92%) Frame = -3 Query: 225 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSRHDVVKRRPVNCNTTHYR 46 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSW GF HDVVKRRPVNCNTTHYR Sbjct: 32 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSW---GFPSHDVVKRRPVNCNTTHYR 88 Query: 45 ANW 37 ANW Sbjct: 89 ANW 91 >SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 107 bits (256), Expect = 5e-24 Identities = 49/60 (81%), Positives = 53/60 (88%) Frame = +2 Query: 71 TGRRFTTS*RENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 TGRRFT ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 40 TGRRFTRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 99 >SB_37427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 102 bits (244), Expect = 1e-22 Identities = 47/60 (78%), Positives = 51/60 (85%) Frame = +2 Query: 71 TGRRFTTS*RENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 TGRR ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 35 TGRRLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 94 >SB_26118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 102 bits (244), Expect = 1e-22 Identities = 47/60 (78%), Positives = 51/60 (85%) Frame = +2 Query: 71 TGRRFTTS*RENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 TGRR ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 45 TGRRLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 104 >SB_57017| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 102 bits (244), Expect = 1e-22 Identities = 47/60 (78%), Positives = 51/60 (85%) Frame = +2 Query: 71 TGRRFTTS*RENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 TGRR ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 72 TGRRLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 131 >SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 101 bits (243), Expect = 2e-22 Identities = 46/55 (83%), Positives = 49/55 (89%) Frame = +2 Query: 71 TGRRFTTS*RENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 235 TGRR ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 15 TGRRLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 69 >SB_27498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 101 bits (243), Expect = 2e-22 Identities = 46/55 (83%), Positives = 49/55 (89%) Frame = +2 Query: 71 TGRRFTTS*RENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 235 TGRR ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 25 TGRRLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 79 >SB_18570| Best HMM Match : Moricin (HMM E-Value=6.5) Length = 107 Score = 100 bits (239), Expect = 5e-22 Identities = 48/55 (87%), Positives = 49/55 (89%) Frame = -2 Query: 235 YNLPFAIQAAQLLGRAIGAGLFAITPAGERGMCCKAIKLGNARVFPSRRCKTTAS 71 + PFAIQAAQLLGRAIGAGLFAITPAGERGMCCKAIKLGNARVFP KTTAS Sbjct: 8 HQAPFAIQAAQLLGRAIGAGLFAITPAGERGMCCKAIKLGNARVFPVTTFKTTAS 62 >SB_48986| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 99 bits (238), Expect = 7e-22 Identities = 47/52 (90%), Positives = 47/52 (90%) Frame = -3 Query: 225 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSRHDVVKRRPV 70 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSW GF HDVVKRRPV Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSW---GFPSHDVVKRRPV 67 >SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1580 Score = 98.7 bits (235), Expect = 2e-21 Identities = 43/48 (89%), Positives = 46/48 (95%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVN 244 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ N Sbjct: 1073 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRQN 1120 >SB_2468| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 98.3 bits (234), Expect = 2e-21 Identities = 46/62 (74%), Positives = 51/62 (82%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNILLNSR*IFVKS 280 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L + KS Sbjct: 81 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLLTHLCEYEGKS 140 Query: 281 AH 286 H Sbjct: 141 GH 142 >SB_14754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 98.3 bits (234), Expect = 2e-21 Identities = 45/57 (78%), Positives = 50/57 (87%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNILLNSR*IF 271 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L + IF Sbjct: 51 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLLTHLCGIF 107 >SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 72 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 121 >SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 35 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 84 >SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 59 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 108 >SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 38 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 87 >SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 917 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 843 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 892 >SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) Length = 195 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 124 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 173 >SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 49 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 98 >SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) Length = 349 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 21 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 70 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 98 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 147 >SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 32 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 81 >SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) Length = 234 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 163 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 212 >SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 67 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 116 >SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 57 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 106 >SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 70 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 119 >SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1615 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 223 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 272 >SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 58 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 107 >SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 50 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 99 >SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 85 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 134 >SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 32 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 81 >SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 67 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 116 >SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) Length = 318 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/54 (79%), Positives = 47/54 (87%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNILLNSR 262 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ + R Sbjct: 110 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRRQVRAKQR 163 >SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) Length = 154 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 83 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 132 >SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 38 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 87 >SB_46412| Best HMM Match : HEAT (HMM E-Value=8) Length = 140 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 69 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 118 >SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 98 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 147 >SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) Length = 181 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 110 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 159 >SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 42 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 91 >SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 135 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 184 >SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 106 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 155 >SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 71 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 120 >SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 94 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 143 >SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) Length = 165 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 94 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 143 >SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 94 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 143 >SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 75 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 124 >SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 34 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 83 >SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 118 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 167 >SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 34 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 83 >SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 53 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 102 >SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 86 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 135 >SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 77 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 126 >SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 172 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 150 >SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 51 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 100 >SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 215 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 144 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 193 >SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) Length = 263 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 192 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 241 >SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 69 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 118 >SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) Length = 227 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 156 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 205 >SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 68 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 117 >SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) Length = 197 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 126 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 175 >SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 33 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 82 >SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) Length = 1060 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 662 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 711 >SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 49 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 98 >SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) Length = 242 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 171 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 220 >SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 32 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 81 >SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 80 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 129 >SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 81 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 130 >SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) Length = 160 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 89 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 138 >SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) Length = 249 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 195 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 244 >SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) Length = 633 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 454 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 503 >SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) Length = 154 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 83 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 132 >SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) Length = 546 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 276 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 325 >SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 44 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 93 >SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 80 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 129 >SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) Length = 185 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 114 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 163 >SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 73 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 122 >SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 83 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 132 >SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 83 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 132 >SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 84 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 133 >SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 93 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 142 >SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) Length = 257 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 186 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 235 >SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 41 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 90 >SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) Length = 164 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 93 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 142 >SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 59 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 108 >SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 78 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 127 >SB_21247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 67 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 116 >SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 79 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 128 >SB_19461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 48 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 97 >SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 54 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 103 >SB_18289| Best HMM Match : IgG_binding_B (HMM E-Value=7) Length = 143 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 72 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 121 >SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05) Length = 162 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 91 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 140 >SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 97 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 146 >SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 185 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 114 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 163 >SB_15493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 48 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 97 >SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 60 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 109 >SB_15295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 59 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 108 >SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) Length = 207 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 136 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 185 >SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 79 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 128 >SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 65 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 114 >SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 64 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 113 >SB_12962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 98 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 147 >SB_12873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 65 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 114 >SB_12187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 104 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 153 >SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 75 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 124 >SB_11632| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 248 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 177 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 226 >SB_10031| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 89 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 138 >SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 67 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 116 >SB_9450| Best HMM Match : CM_1 (HMM E-Value=3.1) Length = 186 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 115 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 164 >SB_8714| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 46 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 95 >SB_8621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 129 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 178 >SB_8582| Best HMM Match : CsgG (HMM E-Value=4.9e-06) Length = 233 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 162 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 211 >SB_8530| Best HMM Match : ThiC (HMM E-Value=2.7e-07) Length = 183 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 112 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 161 >SB_8498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 44 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 93 >SB_6842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 47 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 96 >SB_5521| Best HMM Match : SWIM (HMM E-Value=6.9) Length = 150 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 79 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 128 >SB_5457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 207 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 136 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 185 >SB_3676| Best HMM Match : Cuticle_2 (HMM E-Value=3.2) Length = 322 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 36 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 85 >SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 95 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 144 >SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5) Length = 174 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 103 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 152 >SB_55779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 82 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 131 >SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) Length = 174 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 103 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 152 >SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 117 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 166 >SB_53532| Best HMM Match : IgG_binding_B (HMM E-Value=7.8) Length = 162 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 91 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 140 >SB_52081| Best HMM Match : DUF1634 (HMM E-Value=0.55) Length = 189 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 118 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 167 >SB_51949| Best HMM Match : Toxin_14 (HMM E-Value=0.051) Length = 387 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 316 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 365 >SB_49112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 62 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 111 >SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08) Length = 688 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 25 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 74 >SB_48358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 96 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 36 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 85 >SB_45065| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 66 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 115 >SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 328 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 257 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 306 >SB_43660| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 91 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 140 >SB_43339| Best HMM Match : SAC3_GANP (HMM E-Value=1.8e-09) Length = 657 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 44 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 93 >SB_42664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 58 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 107 >SB_41564| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 34 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 83 >SB_41244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 268 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 214 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 263 >SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 73 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 122 >SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092) Length = 783 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 729 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 778 >SB_35835| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 49 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 98 >SB_31775| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 551 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 197 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 246 >SB_30891| Best HMM Match : LIM (HMM E-Value=4.40008e-43) Length = 511 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 125 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 174 >SB_30664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 40 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 89 >SB_29747| Best HMM Match : Ank (HMM E-Value=0) Length = 416 Score = 97.9 bits (233), Expect = 3e-21 Identities = 50/80 (62%), Positives = 53/80 (66%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNILLNSR*IFVKS 280 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW L + Sbjct: 301 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWDAPCSGAL--------SA 352 Query: 281 AHFLTNRPKSAKSLINQKNR 340 A + R K L+N K R Sbjct: 353 AGVVVTRSNGGKGLLNTKER 372 >SB_28552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 30 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 79 >SB_27244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 95 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 144 >SB_26386| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 42 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 91 >SB_25785| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 119 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 168 >SB_22440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 31 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 80 >SB_20758| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 47 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 96 >SB_19831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 70 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 119 >SB_19310| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 31 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 80 >SB_12047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 77 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 126 >SB_11928| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 54 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 103 >SB_11382| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 72 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 121 >SB_8032| Best HMM Match : IBB (HMM E-Value=0.46) Length = 191 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 131 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 180 >SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) Length = 150 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 79 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 128 >SB_7742| Best HMM Match : HEAT (HMM E-Value=9e-23) Length = 940 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 374 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 423 >SB_7402| Best HMM Match : Extensin_2 (HMM E-Value=2) Length = 267 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 51 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 100 >SB_5394| Best HMM Match : PEGSRP (HMM E-Value=1.5) Length = 144 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 64 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 113 >SB_372| Best HMM Match : CBM_2 (HMM E-Value=0.00043) Length = 630 Score = 97.9 bits (233), Expect = 3e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 250 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 447 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 496 >SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 97.5 bits (232), Expect = 4e-21 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 235 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 26 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 >SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 97.5 bits (232), Expect = 4e-21 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 235 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 39 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 83 >SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 97.5 bits (232), Expect = 4e-21 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 235 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 28 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 72 >SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 97.5 bits (232), Expect = 4e-21 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 235 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 26 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 >SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 97.5 bits (232), Expect = 4e-21 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 235 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 26 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 >SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 97.5 bits (232), Expect = 4e-21 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 235 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 30 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 74 >SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 97.5 bits (232), Expect = 4e-21 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 235 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 29 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 73 >SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 97.5 bits (232), Expect = 4e-21 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 235 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 47 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 91 >SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 97.5 bits (232), Expect = 4e-21 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 235 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 142 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 186 >SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 97.5 bits (232), Expect = 4e-21 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 235 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 31 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 75 >SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 97.5 bits (232), Expect = 4e-21 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 235 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 26 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 >SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 97.5 bits (232), Expect = 4e-21 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 235 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 43 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 87 >SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 562 Score = 97.5 bits (232), Expect = 4e-21 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 235 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 156 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 200 >SB_46308| Best HMM Match : IMS (HMM E-Value=0) Length = 1245 Score = 97.5 bits (232), Expect = 4e-21 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 235 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 1200 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 1244 Score = 82.6 bits (195), Expect = 1e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -3 Query: 225 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSW 118 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSW Sbjct: 404 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSW 439 >SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 97.5 bits (232), Expect = 4e-21 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 235 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 87 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 131 >SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 97.5 bits (232), Expect = 4e-21 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 235 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 41 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 85 >SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 97.5 bits (232), Expect = 4e-21 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 235 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 26 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 >SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 97.5 bits (232), Expect = 4e-21 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 235 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 44 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 88 >SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 97.5 bits (232), Expect = 4e-21 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 235 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 46 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 90 >SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 97.5 bits (232), Expect = 4e-21 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 235 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 50 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 94 >SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 97.5 bits (232), Expect = 4e-21 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 235 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 31 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 75 >SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 97.5 bits (232), Expect = 4e-21 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 235 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 26 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 >SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 97.5 bits (232), Expect = 4e-21 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 235 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 27 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 71 >SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 97.5 bits (232), Expect = 4e-21 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 235 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 41 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 85 >SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 397 Score = 97.5 bits (232), Expect = 4e-21 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 235 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 180 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 224 >SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 97.5 bits (232), Expect = 4e-21 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 235 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 29 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 73 >SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 102 Score = 97.5 bits (232), Expect = 4e-21 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 235 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 57 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 101 >SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 97.5 bits (232), Expect = 4e-21 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 235 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 42 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 86 >SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 97.5 bits (232), Expect = 4e-21 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 235 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 68 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 112 >SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 97.5 bits (232), Expect = 4e-21 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 235 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 27 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 71 >SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 97.5 bits (232), Expect = 4e-21 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 235 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 70 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 114 Score = 68.1 bits (159), Expect = 3e-12 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = +2 Query: 128 RLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 223 +++AHPPFASWRNSEEARTDRPSQQLRSLNGE Sbjct: 14 QVSAHPPFASWRNSEEARTDRPSQQLRSLNGE 45 >SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 97.5 bits (232), Expect = 4e-21 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 235 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 30 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 74 >SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 116 Score = 97.5 bits (232), Expect = 4e-21 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 235 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 71 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 115 >SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 97.5 bits (232), Expect = 4e-21 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 235 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 27 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 71 >SB_24181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 97.5 bits (232), Expect = 4e-21 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 235 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 30 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 74 >SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6) Length = 128 Score = 97.5 bits (232), Expect = 4e-21 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 235 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 83 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 127 >SB_22468| Best HMM Match : CUT (HMM E-Value=6.8) Length = 197 Score = 97.5 bits (232), Expect = 4e-21 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 235 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 152 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 196 >SB_20839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 97.5 bits (232), Expect = 4e-21 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 235 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 30 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 74 >SB_20747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 97.5 bits (232), Expect = 4e-21 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 235 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 26 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 >SB_16725| Best HMM Match : DAGAT (HMM E-Value=1e-39) Length = 571 Score = 97.5 bits (232), Expect = 4e-21 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 235 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 201 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 245 >SB_15150| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 96 Score = 97.5 bits (232), Expect = 4e-21 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 235 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 51 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 95 >SB_15134| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 97.5 bits (232), Expect = 4e-21 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 235 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 32 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 76 >SB_15127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 97.5 bits (232), Expect = 4e-21 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 235 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 30 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 74 >SB_14862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 97.5 bits (232), Expect = 4e-21 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 235 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 53 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 97 >SB_13372| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 97.5 bits (232), Expect = 4e-21 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 235 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 28 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 72 >SB_12726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 97.5 bits (232), Expect = 4e-21 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 235 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 68 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 112 >SB_12236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 97.5 bits (232), Expect = 4e-21 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 235 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 30 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 74 >SB_11249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 97.5 bits (232), Expect = 4e-21 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 235 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 72 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 116 >SB_10911| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 97.5 bits (232), Expect = 4e-21 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 235 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 52 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 96 >SB_10687| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 97.5 bits (232), Expect = 4e-21 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 235 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 27 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 71 >SB_10456| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 97.5 bits (232), Expect = 4e-21 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 235 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 43 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 87 >SB_9697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 97.5 bits (232), Expect = 4e-21 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 235 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 44 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 88 >SB_8806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 97.5 bits (232), Expect = 4e-21 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 235 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 56 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 100 >SB_7973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 97.5 bits (232), Expect = 4e-21 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 235 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 36 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 80 >SB_7142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 97.5 bits (232), Expect = 4e-21 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 235 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 65 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 109 >SB_6464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 97.5 bits (232), Expect = 4e-21 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 235 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 66 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 110 >SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 211 Score = 97.5 bits (232), Expect = 4e-21 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 235 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 166 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 210 >SB_6070| Best HMM Match : PEGSRP (HMM E-Value=3.8) Length = 82 Score = 97.5 bits (232), Expect = 4e-21 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 235 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 37 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 81 >SB_4705| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 97.5 bits (232), Expect = 4e-21 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 235 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 68 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 112 >SB_4191| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 97.5 bits (232), Expect = 4e-21 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 235 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 99 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 143 >SB_3728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 97.5 bits (232), Expect = 4e-21 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 235 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 28 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 72 >SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 97.5 bits (232), Expect = 4e-21 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 235 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 54 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 98 >SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 97.5 bits (232), Expect = 4e-21 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 235 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 155 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 199 >SB_55925| Best HMM Match : Homeobox (HMM E-Value=1e-26) Length = 1064 Score = 97.5 bits (232), Expect = 4e-21 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 235 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 801 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 845 >SB_55030| Best HMM Match : Toxin_27 (HMM E-Value=1.2) Length = 110 Score = 97.5 bits (232), Expect = 4e-21 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 235 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 65 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 109 >SB_54425| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 97.5 bits (232), Expect = 4e-21 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 235 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 26 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 >SB_51954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 97.5 bits (232), Expect = 4e-21 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 235 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 26 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 >SB_51253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 85 Score = 97.5 bits (232), Expect = 4e-21 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 235 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 40 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 84 >SB_46185| Best HMM Match : Flt3_lig (HMM E-Value=3.3) Length = 292 Score = 97.5 bits (232), Expect = 4e-21 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 235 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 63 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 107 >SB_45537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 97.5 bits (232), Expect = 4e-21 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 235 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 26 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 >SB_42518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 97.5 bits (232), Expect = 4e-21 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 235 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 26 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 >SB_39279| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 97.5 bits (232), Expect = 4e-21 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 235 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 28 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 72 >SB_36908| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 90 Score = 97.5 bits (232), Expect = 4e-21 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 235 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 45 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 89 >SB_34678| Best HMM Match : Bromodomain (HMM E-Value=9e-25) Length = 1137 Score = 97.5 bits (232), Expect = 4e-21 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 235 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 539 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 583 >SB_34602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 97.5 bits (232), Expect = 4e-21 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 235 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 47 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 91 >SB_32133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 97.5 bits (232), Expect = 4e-21 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 235 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 26 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 >SB_31269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 97.5 bits (232), Expect = 4e-21 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 235 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 26 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 >SB_27230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 97.5 bits (232), Expect = 4e-21 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 235 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 21 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 65 >SB_20620| Best HMM Match : zf-HIT (HMM E-Value=8.5e-10) Length = 567 Score = 97.5 bits (232), Expect = 4e-21 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 235 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 208 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 252 >SB_20378| Best HMM Match : Adeno_E1B_19K (HMM E-Value=5.7) Length = 132 Score = 97.5 bits (232), Expect = 4e-21 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 235 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 61 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 105 >SB_20169| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 97.5 bits (232), Expect = 4e-21 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 235 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 25 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 69 >SB_19077| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 97.5 bits (232), Expect = 4e-21 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 235 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 26 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 >SB_15849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 97.5 bits (232), Expect = 4e-21 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 235 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 37 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 81 >SB_12231| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 97.5 bits (232), Expect = 4e-21 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 235 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 30 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 74 >SB_11962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 97.5 bits (232), Expect = 4e-21 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 235 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 34 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 78 >SB_11225| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 97.5 bits (232), Expect = 4e-21 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 235 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 50 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 94 >SB_9128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 97.5 bits (232), Expect = 4e-21 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 235 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 30 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 74 >SB_6875| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 97.5 bits (232), Expect = 4e-21 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +2 Query: 101 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 235 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 46 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 90 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,197,619 Number of Sequences: 59808 Number of extensions: 267261 Number of successful extensions: 7968 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 4939 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7955 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 752487277 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -