BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0385.Seq (414 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BX537865-1|CAD97868.1| 303|Homo sapiens hypothetical protein pr... 31 2.0 BC041365-1|AAH41365.1| 77|Homo sapiens KLHDC6 protein protein. 31 2.0 AK128176-1|BAC87309.1| 198|Homo sapiens protein ( Homo sapiens ... 31 2.0 BC146765-1|AAI46766.1| 1531|Homo sapiens nuclear factor of activ... 29 6.1 AJ243299-1|CAC42765.1| 1484|Homo sapiens tonicity-responsive enh... 29 6.1 AJ243298-1|CAC42764.1| 1455|Homo sapiens tonicity-responsive enh... 29 6.1 AF346509-1|AAK91166.1| 1455|Homo sapiens nuclear factor of activ... 29 6.1 AF163836-1|AAD48441.1| 1484|Homo sapiens transcription factor NF... 29 6.1 AF134870-1|AAD38360.1| 1455|Homo sapiens transcription factor NF... 29 6.1 AF089824-1|AAD18136.1| 1455|Homo sapiens tonicity-responsive enh... 29 6.1 AB020634-1|BAA74850.2| 1608|Homo sapiens KIAA0827 protein protein. 29 6.1 >BX537865-1|CAD97868.1| 303|Homo sapiens hypothetical protein protein. Length = 303 Score = 30.7 bits (66), Expect = 2.0 Identities = 16/31 (51%), Positives = 18/31 (58%) Frame = +2 Query: 107 YDVLLTAKYERGNPKSLLPGPQDL*CSGNRH 199 YDV L A R NP+ L+P P DL GN H Sbjct: 276 YDVCLVA---RMNPRDLIPPPSDLVEEGNEH 303 >BC041365-1|AAH41365.1| 77|Homo sapiens KLHDC6 protein protein. Length = 77 Score = 30.7 bits (66), Expect = 2.0 Identities = 16/31 (51%), Positives = 18/31 (58%) Frame = +2 Query: 107 YDVLLTAKYERGNPKSLLPGPQDL*CSGNRH 199 YDV L A R NP+ L+P P DL GN H Sbjct: 50 YDVCLVA---RMNPRDLIPPPSDLVEEGNEH 77 >AK128176-1|BAC87309.1| 198|Homo sapiens protein ( Homo sapiens cDNA FLJ46299 fis, clone TESTI4035898. ). Length = 198 Score = 30.7 bits (66), Expect = 2.0 Identities = 16/31 (51%), Positives = 18/31 (58%) Frame = +2 Query: 107 YDVLLTAKYERGNPKSLLPGPQDL*CSGNRH 199 YDV L A R NP+ L+P P DL GN H Sbjct: 171 YDVCLVA---RMNPRDLIPPPSDLVEEGNEH 198 >BC146765-1|AAI46766.1| 1531|Homo sapiens nuclear factor of activated T-cells 5, tonicity-responsive protein. Length = 1531 Score = 29.1 bits (62), Expect = 6.1 Identities = 20/64 (31%), Positives = 30/64 (46%), Gaps = 4/64 (6%) Frame = -1 Query: 393 ENTWLSRREASYGIFNMNSRGLKTH*YRPQ---LPLEPS-HLLKNAYRRRGLLSGTYSPV 226 EN+W S E +F+ N +K Y Q LP+ +++ NA R + TY+P Sbjct: 485 ENSWKSEAEIDMELFHQNHLIVKVPPYHDQHITLPVSVGIYVVTNAGRSHDVQPFTYTPD 544 Query: 225 PLEA 214 P A Sbjct: 545 PAAA 548 >AJ243299-1|CAC42765.1| 1484|Homo sapiens tonicity-responsive enhancer binding protein protein. Length = 1484 Score = 29.1 bits (62), Expect = 6.1 Identities = 20/64 (31%), Positives = 30/64 (46%), Gaps = 4/64 (6%) Frame = -1 Query: 393 ENTWLSRREASYGIFNMNSRGLKTH*YRPQ---LPLEPS-HLLKNAYRRRGLLSGTYSPV 226 EN+W S E +F+ N +K Y Q LP+ +++ NA R + TY+P Sbjct: 438 ENSWKSEAEIDMELFHQNHLIVKVPPYHDQHITLPVSVGIYVVTNAGRSHDVQPFTYTPD 497 Query: 225 PLEA 214 P A Sbjct: 498 PAAA 501 >AJ243298-1|CAC42764.1| 1455|Homo sapiens tonicity-responsive enhancer binding protein protein. Length = 1455 Score = 29.1 bits (62), Expect = 6.1 Identities = 20/64 (31%), Positives = 30/64 (46%), Gaps = 4/64 (6%) Frame = -1 Query: 393 ENTWLSRREASYGIFNMNSRGLKTH*YRPQ---LPLEPS-HLLKNAYRRRGLLSGTYSPV 226 EN+W S E +F+ N +K Y Q LP+ +++ NA R + TY+P Sbjct: 409 ENSWKSEAEIDMELFHQNHLIVKVPPYHDQHITLPVSVGIYVVTNAGRSHDVQPFTYTPD 468 Query: 225 PLEA 214 P A Sbjct: 469 PAAA 472 >AF346509-1|AAK91166.1| 1455|Homo sapiens nuclear factor of activated T-cells protein. Length = 1455 Score = 29.1 bits (62), Expect = 6.1 Identities = 20/64 (31%), Positives = 30/64 (46%), Gaps = 4/64 (6%) Frame = -1 Query: 393 ENTWLSRREASYGIFNMNSRGLKTH*YRPQ---LPLEPS-HLLKNAYRRRGLLSGTYSPV 226 EN+W S E +F+ N +K Y Q LP+ +++ NA R + TY+P Sbjct: 409 ENSWKSEAEIDMELFHQNHLIVKVPPYHDQHITLPVSVGIYVVTNAGRSHDVQPFTYTPD 468 Query: 225 PLEA 214 P A Sbjct: 469 PAAA 472 >AF163836-1|AAD48441.1| 1484|Homo sapiens transcription factor NFAT5 isoform b protein. Length = 1484 Score = 29.1 bits (62), Expect = 6.1 Identities = 20/64 (31%), Positives = 30/64 (46%), Gaps = 4/64 (6%) Frame = -1 Query: 393 ENTWLSRREASYGIFNMNSRGLKTH*YRPQ---LPLEPS-HLLKNAYRRRGLLSGTYSPV 226 EN+W S E +F+ N +K Y Q LP+ +++ NA R + TY+P Sbjct: 438 ENSWKSEAEIDMELFHQNHLIVKVPPYHDQHITLPVSVGIYVVTNAGRSHDVQPFTYTPD 497 Query: 225 PLEA 214 P A Sbjct: 498 PAAA 501 >AF134870-1|AAD38360.1| 1455|Homo sapiens transcription factor NFAT5 protein. Length = 1455 Score = 29.1 bits (62), Expect = 6.1 Identities = 20/64 (31%), Positives = 30/64 (46%), Gaps = 4/64 (6%) Frame = -1 Query: 393 ENTWLSRREASYGIFNMNSRGLKTH*YRPQ---LPLEPS-HLLKNAYRRRGLLSGTYSPV 226 EN+W S E +F+ N +K Y Q LP+ +++ NA R + TY+P Sbjct: 409 ENSWKSEAEIDMELFHQNHLIVKVPPYHDQHITLPVSVGIYVVTNAGRSHDVQPFTYTPD 468 Query: 225 PLEA 214 P A Sbjct: 469 PAAA 472 >AF089824-1|AAD18136.1| 1455|Homo sapiens tonicity-responsive enhancer-binding protein protein. Length = 1455 Score = 29.1 bits (62), Expect = 6.1 Identities = 20/64 (31%), Positives = 30/64 (46%), Gaps = 4/64 (6%) Frame = -1 Query: 393 ENTWLSRREASYGIFNMNSRGLKTH*YRPQ---LPLEPS-HLLKNAYRRRGLLSGTYSPV 226 EN+W S E +F+ N +K Y Q LP+ +++ NA R + TY+P Sbjct: 409 ENSWKSEAEIDMELFHQNHLIVKVPPYHDQHITLPVSVGIYVVTNAGRSHDVQPFTYTPD 468 Query: 225 PLEA 214 P A Sbjct: 469 PAAA 472 >AB020634-1|BAA74850.2| 1608|Homo sapiens KIAA0827 protein protein. Length = 1608 Score = 29.1 bits (62), Expect = 6.1 Identities = 20/64 (31%), Positives = 30/64 (46%), Gaps = 4/64 (6%) Frame = -1 Query: 393 ENTWLSRREASYGIFNMNSRGLKTH*YRPQ---LPLEPS-HLLKNAYRRRGLLSGTYSPV 226 EN+W S E +F+ N +K Y Q LP+ +++ NA R + TY+P Sbjct: 562 ENSWKSEAEIDMELFHQNHLIVKVPPYHDQHITLPVSVGIYVVTNAGRSHDVQPFTYTPD 621 Query: 225 PLEA 214 P A Sbjct: 622 PAAA 625 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 56,843,210 Number of Sequences: 237096 Number of extensions: 1075452 Number of successful extensions: 1610 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 1600 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1610 length of database: 76,859,062 effective HSP length: 83 effective length of database: 57,180,094 effective search space used: 3087725076 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -