BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0382.Seq (508 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1840.05c |||phosphomannomutase |Schizosaccharomyces pombe|ch... 25 4.9 SPAC20G8.06 |||CCR4-Not complex subunit Not1 |Schizosaccharomyce... 25 6.5 >SPCC1840.05c |||phosphomannomutase |Schizosaccharomyces pombe|chr 3|||Manual Length = 587 Score = 25.4 bits (53), Expect = 4.9 Identities = 15/37 (40%), Positives = 19/37 (51%) Frame = -1 Query: 418 YEVEKIVRSKDGPVRTTSALDFMKRWP*LNLTLV*VF 308 Y V IVR KDG + L +KR NL++ VF Sbjct: 409 YMVGSIVRDKDGVNALITFLHLLKRLQLQNLSITEVF 445 >SPAC20G8.06 |||CCR4-Not complex subunit Not1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 2100 Score = 25.0 bits (52), Expect = 6.5 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = +2 Query: 44 LNLILPITNNHAITLHTAKKTN 109 L IL I NN+A TL ++KTN Sbjct: 942 LQAILDIMNNNAETLSPSEKTN 963 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,935,779 Number of Sequences: 5004 Number of extensions: 34904 Number of successful extensions: 75 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 73 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 75 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 202220600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -