BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0382.Seq (508 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_04_0210 - 20949938-20949976,20950135-20950192,20950447-209505... 27 6.5 01_06_1276 - 35918954-35919106,35919220-35919325,35919477-359195... 27 8.7 >02_04_0210 - 20949938-20949976,20950135-20950192,20950447-20950538, 20950620-20950982 Length = 183 Score = 27.5 bits (58), Expect = 6.5 Identities = 12/39 (30%), Positives = 22/39 (56%) Frame = +2 Query: 53 ILPITNNHAITLHTAKKTNSNYSYLVHNTTKTVGLNYQF 169 +LP +N+ + T K + +S L+H KT+GL + + Sbjct: 108 VLPCSNSRS-TSGNQSKMETEFSELLHAAEKTIGLYFSY 145 >01_06_1276 - 35918954-35919106,35919220-35919325,35919477-35919574, 35919693-35919757,35919877-35920033,35920177-35920268, 35920379-35920493,35920574-35920622,35920705-35920858, 35920993-35921019,35921530-35921707,35922326-35922685, 35922979-35922987,35923170-35923238 Length = 543 Score = 27.1 bits (57), Expect = 8.7 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = +3 Query: 375 RTGPSLLLTIFSTSYRPFPISLV 443 R GPSL + SYR FPI LV Sbjct: 286 RLGPSLYDFLRKNSYRAFPIDLV 308 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,508,708 Number of Sequences: 37544 Number of extensions: 197716 Number of successful extensions: 271 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 269 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 271 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1083123860 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -