BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0380.Seq (648 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nu... 23 2.2 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 22 5.0 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 22 5.0 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 22 5.0 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 22 5.0 >AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nuclear receptor protein. Length = 407 Score = 23.0 bits (47), Expect = 2.2 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +2 Query: 314 FKVLYIAVRATHRNKPKRNAKLSL 385 + VL R TH N+P R AKL L Sbjct: 343 YGVLEEYTRTTHPNEPGRFAKLLL 366 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.8 bits (44), Expect = 5.0 Identities = 15/47 (31%), Positives = 22/47 (46%) Frame = -2 Query: 395 YFN*VKV*RFSLVCFDASPAPLCIVL*ILHCTCFVIIINIIYVDNPL 255 Y+N + + F LVCF IV IL T + +I+ + V L Sbjct: 948 YYNIIPILFFMLVCFTCKSNIQLIVAQIL-STGYALIMMAVIVGTAL 993 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.8 bits (44), Expect = 5.0 Identities = 15/47 (31%), Positives = 22/47 (46%) Frame = -2 Query: 395 YFN*VKV*RFSLVCFDASPAPLCIVL*ILHCTCFVIIINIIYVDNPL 255 Y+N + + F LVCF IV IL T + +I+ + V L Sbjct: 948 YYNIIPILFFMLVCFTCKSNIQLIVAQIL-STGYALIMMAVIVGTAL 993 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.8 bits (44), Expect = 5.0 Identities = 15/47 (31%), Positives = 22/47 (46%) Frame = -2 Query: 395 YFN*VKV*RFSLVCFDASPAPLCIVL*ILHCTCFVIIINIIYVDNPL 255 Y+N + + F LVCF IV IL T + +I+ + V L Sbjct: 948 YYNIIPILFFMLVCFTCKSNIQLIVAQIL-STGYALIMMAVIVGTAL 993 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.8 bits (44), Expect = 5.0 Identities = 15/47 (31%), Positives = 22/47 (46%) Frame = -2 Query: 395 YFN*VKV*RFSLVCFDASPAPLCIVL*ILHCTCFVIIINIIYVDNPL 255 Y+N + + F LVCF IV IL T + +I+ + V L Sbjct: 948 YYNIIPILFFMLVCFTCKSNIQLIVAQIL-STGYALIMMAVIVGTAL 993 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 125,800 Number of Sequences: 336 Number of extensions: 2423 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16656800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -