BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0379.Seq (597 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292381-1|CAL23193.2| 364|Tribolium castaneum gustatory recept... 25 0.37 S73225-1|AAB30811.1| 327|Tribolium castaneum protein ( Triboliu... 21 6.0 AM292349-1|CAL23161.1| 248|Tribolium castaneum gustatory recept... 21 7.9 >AM292381-1|CAL23193.2| 364|Tribolium castaneum gustatory receptor candidate 60 protein. Length = 364 Score = 25.4 bits (53), Expect = 0.37 Identities = 8/16 (50%), Positives = 14/16 (87%) Frame = +2 Query: 41 LVSNTFALIYYMYTLV 88 +V +TF +++YMYTL+ Sbjct: 41 IVVSTFNIVFYMYTLI 56 >S73225-1|AAB30811.1| 327|Tribolium castaneum protein ( Tribolium castaneum homeodomainprotein mRNA, complete cds. ). Length = 327 Score = 21.4 bits (43), Expect = 6.0 Identities = 19/62 (30%), Positives = 29/62 (46%) Frame = +1 Query: 94 T*KCPKHTFCSKCESSSNLRLKDSKIKLQFHSIAYSTTNILYALV*QAITTPIHNYK*KY 273 T + P+H + K ++N + +K +S NIL A + IT PI+ K K Sbjct: 103 TPESPEHYYNQKTLQANNNDASNGNLK-------FSIDNILKADFGRRITDPINIRKCKP 155 Query: 274 KT 279 KT Sbjct: 156 KT 157 >AM292349-1|CAL23161.1| 248|Tribolium castaneum gustatory receptor candidate 28 protein. Length = 248 Score = 21.0 bits (42), Expect = 7.9 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = +2 Query: 44 VSNTFALIYYMYTLVSVHENVLN 112 VSN F +++ Y + ++ VLN Sbjct: 103 VSNVFDFVHFYYPVATMSFYVLN 125 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 121,412 Number of Sequences: 336 Number of extensions: 2405 Number of successful extensions: 7 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15039504 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -