BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0379.Seq (597 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_02_0299 + 15487202-15487227,15487369-15487491,15488277-154883... 29 3.7 >08_02_0299 + 15487202-15487227,15487369-15487491,15488277-15488397, 15488572-15488700,15489954-15490063,15490139-15490322, 15491155-15491346,15492190-15492411,15492501-15492687, 15494009-15494103 Length = 462 Score = 28.7 bits (61), Expect = 3.7 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = -2 Query: 479 HYVLSNRKCNLNRFDSXQLIT*TKNQLSTINCN 381 HY+ N K + FD+ QLI+ T NCN Sbjct: 161 HYICPNCKKRYSAFDALQLISYTDEYFHCENCN 193 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,077,529 Number of Sequences: 37544 Number of extensions: 175042 Number of successful extensions: 276 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 273 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 276 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1423789920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -