BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0379.Seq (597 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U14635-10|AAM81107.1| 552|Caenorhabditis elegans Abnormal dye f... 31 0.62 U14635-9|AAK84493.1| 574|Caenorhabditis elegans Abnormal dye fi... 31 0.62 >U14635-10|AAM81107.1| 552|Caenorhabditis elegans Abnormal dye filling protein 13,isoform b protein. Length = 552 Score = 31.1 bits (67), Expect = 0.62 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = +1 Query: 100 KCPKHTFCSKCESSSNLRLKDSKIKLQFHS 189 KCPK C + + +LRL D K L FHS Sbjct: 94 KCPKTPLCIRLMMNVSLRLNDEKRILTFHS 123 >U14635-9|AAK84493.1| 574|Caenorhabditis elegans Abnormal dye filling protein 13,isoform a protein. Length = 574 Score = 31.1 bits (67), Expect = 0.62 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = +1 Query: 100 KCPKHTFCSKCESSSNLRLKDSKIKLQFHS 189 KCPK C + + +LRL D K L FHS Sbjct: 116 KCPKTPLCIRLMMNVSLRLNDEKRILTFHS 145 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,233,515 Number of Sequences: 27780 Number of extensions: 209077 Number of successful extensions: 439 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 436 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 439 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1268802960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -