BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0378.Seq (352 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 21 2.8 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 20 6.4 AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory recept... 20 6.4 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 21.4 bits (43), Expect = 2.8 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = -2 Query: 225 SNQCYWNCRWMIHFHHDCWNCIHKCCY 145 SN+C++ + I CWN + C Y Sbjct: 1112 SNRCFFPSKIRI-----CWNVLLNCVY 1133 Score = 20.2 bits (40), Expect = 6.4 Identities = 9/37 (24%), Positives = 18/37 (48%) Frame = -2 Query: 141 QMYWILRCLSLNQCYWNCRWMIHFHHDCWNCIHKCCY 31 Q++ ++ N+C++ + I CWN + C Y Sbjct: 1102 QIFGLITFGCSNRCFFPSKIRI-----CWNVLLNCVY 1133 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 20.2 bits (40), Expect = 6.4 Identities = 9/27 (33%), Positives = 13/27 (48%) Frame = -3 Query: 293 HDSWNCLHESCYRGFPGSYAV*IRISV 213 HDSW Y+ G A I++S+ Sbjct: 1447 HDSWADFDNQFYKRVTGYKAKGIKVSL 1473 >AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory receptor candidate 59 protein. Length = 489 Score = 20.2 bits (40), Expect = 6.4 Identities = 4/15 (26%), Positives = 11/15 (73%) Frame = -2 Query: 198 WMIHFHHDCWNCIHK 154 +M+H ++ W C+++ Sbjct: 152 FMLHCNNTTWRCLYR 166 Score = 20.2 bits (40), Expect = 6.4 Identities = 4/15 (26%), Positives = 11/15 (73%) Frame = -2 Query: 84 WMIHFHHDCWNCIHK 40 +M+H ++ W C+++ Sbjct: 152 FMLHCNNTTWRCLYR 166 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 67,429 Number of Sequences: 336 Number of extensions: 1480 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 50 effective length of database: 105,785 effective search space used: 6981810 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -