BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0378.Seq (352 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_3575| Best HMM Match : DUF943 (HMM E-Value=4.5) 35 0.016 SB_39684| Best HMM Match : Tom7 (HMM E-Value=5.1) 33 0.049 SB_43520| Best HMM Match : RNase_PH (HMM E-Value=0.00011) 32 0.15 SB_49209| Best HMM Match : Vicilin_N (HMM E-Value=0.23) 31 0.26 SB_45986| Best HMM Match : Extensin_2 (HMM E-Value=0.12) 30 0.61 SB_30503| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.61 SB_32428| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.9 SB_19226| Best HMM Match : I-set (HMM E-Value=0) 28 1.9 SB_15415| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.9 SB_48089| Best HMM Match : DUF638 (HMM E-Value=3.3) 28 1.9 SB_40994| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.9 SB_13966| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.2 SB_21618| Best HMM Match : Yip1 (HMM E-Value=1.1) 27 4.3 SB_53803| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.3 SB_30469| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.3 SB_16535| Best HMM Match : ShTK (HMM E-Value=2.2e-18) 27 5.7 SB_34085| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 7.5 SB_653| Best HMM Match : Sas10_Utp3 (HMM E-Value=2.2) 26 7.5 SB_41418| Best HMM Match : EGF_CA (HMM E-Value=0) 26 9.9 SB_33280| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.9 SB_7831| Best HMM Match : RNA_pol_Rpb1_7 (HMM E-Value=0) 26 9.9 SB_39230| Best HMM Match : SNF2_N (HMM E-Value=1.40004e-41) 26 9.9 >SB_3575| Best HMM Match : DUF943 (HMM E-Value=4.5) Length = 612 Score = 35.1 bits (77), Expect = 0.016 Identities = 18/60 (30%), Positives = 27/60 (45%), Gaps = 1/60 (1%) Frame = -2 Query: 183 HHDCWNCIHKCCY-HQMYWILRCLSLNQCYWNCRWMIHFHHDCWNCIHKCCYRQMFWILR 7 H+ C+ H CCY H Y C + Y C + H+H+ C+ + CYR + R Sbjct: 13 HNRCYRHHHYCCYCHHRY----CYYRHHHY--CWYRHHYHYPCYRHYYHRCYRHHYCCYR 66 >SB_39684| Best HMM Match : Tom7 (HMM E-Value=5.1) Length = 424 Score = 33.5 bits (73), Expect = 0.049 Identities = 25/78 (32%), Positives = 42/78 (53%) Frame = +1 Query: 4 TAKDPEHLAVAALMDTVPTVVMEVYHPPAVPVTLVQTQTAQDPVHLVVAALMDTVPTVVM 183 + K+ H+ + + V T V H P V VTLV+ +A++ VH+ + + V T+ Sbjct: 321 STKEVVHIPLVVTLLKV-TSAKVVVHIPLV-VTLVKVTSAKEVVHIPLVVTLVKV-TIAK 377 Query: 184 KVYHPPAVPVTLIRIQTA 237 V H P V VTL+++ +A Sbjct: 378 VVVHIPLV-VTLVKVTSA 394 Score = 31.9 bits (69), Expect = 0.15 Identities = 25/78 (32%), Positives = 43/78 (55%) Frame = +1 Query: 4 TAKDPEHLAVAALMDTVPTVVMEVYHPPAVPVTLVQTQTAQDPVHLVVAALMDTVPTVVM 183 +AK H+ + + V + + V H P V VTLV+ +A++ VH+ + + V T Sbjct: 177 SAKVMVHIPLVVTLVKVTSAEL-VVHIPLV-VTLVEVTSAKEVVHIPLVVTLLKV-TSAE 233 Query: 184 KVYHPPAVPVTLIRIQTA 237 +V H P V VTL+++ +A Sbjct: 234 EVVHIPLV-VTLLKVTSA 250 Score = 31.9 bits (69), Expect = 0.15 Identities = 22/60 (36%), Positives = 34/60 (56%) Frame = +1 Query: 58 TVVMEVYHPPAVPVTLVQTQTAQDPVHLVVAALMDTVPTVVMKVYHPPAVPVTLIRIQTA 237 T EV H P V VTL++ +A++ VH+ + + V T V H P V VTL+++ +A Sbjct: 212 TSAKEVVHIPLV-VTLLKVTSAEEVVHIPLVVTLLKV-TSAKVVVHIPLV-VTLVKVTSA 268 Score = 29.9 bits (64), Expect = 0.61 Identities = 26/79 (32%), Positives = 43/79 (54%), Gaps = 1/79 (1%) Frame = +1 Query: 4 TAKDPEHLAVAALMDTVPTVVMEVYHPPAVPVTLVQTQTAQDPVHL-VVAALMDTVPTVV 180 +AK H+ + + V + + V H P V VTLV+ +A+ VH+ +V L++ V Sbjct: 123 SAKVMVHIPLVVTLVKVTSAEL-VVHIPLV-VTLVEVTSAKVVVHIPLVVTLVNVTSAKV 180 Query: 181 MKVYHPPAVPVTLIRIQTA 237 M H P V VTL+++ +A Sbjct: 181 M--VHIPLV-VTLVKVTSA 196 Score = 29.5 bits (63), Expect = 0.80 Identities = 25/78 (32%), Positives = 41/78 (52%) Frame = +1 Query: 4 TAKDPEHLAVAALMDTVPTVVMEVYHPPAVPVTLVQTQTAQDPVHLVVAALMDTVPTVVM 183 +A++ H+ + + V T V H P V VTLV+ +A+ VH+ + + V T Sbjct: 231 SAEEVVHIPLVVTLLKV-TSAKVVVHIPLV-VTLVKVTSAELVVHIPLVVTLVEV-TSAK 287 Query: 184 KVYHPPAVPVTLIRIQTA 237 V H P V VTL+++ +A Sbjct: 288 VVVHIPLV-VTLVKVTSA 304 Score = 29.1 bits (62), Expect = 1.1 Identities = 24/78 (30%), Positives = 41/78 (52%) Frame = +1 Query: 4 TAKDPEHLAVAALMDTVPTVVMEVYHPPAVPVTLVQTQTAQDPVHLVVAALMDTVPTVVM 183 +A++ H+ + + V T V H P V VTLV+ +A+ VH+ + + V + + Sbjct: 87 SAEEVVHIPLVVTLLKV-TSAKVVVHIPLV-VTLVEVTSAKVMVHIPLVVTLVKVTSAEL 144 Query: 184 KVYHPPAVPVTLIRIQTA 237 V H P V VTL+ + +A Sbjct: 145 -VVHIPLV-VTLVEVTSA 160 Score = 28.3 bits (60), Expect = 1.9 Identities = 20/55 (36%), Positives = 31/55 (56%) Frame = +1 Query: 73 VYHPPAVPVTLVQTQTAQDPVHLVVAALMDTVPTVVMKVYHPPAVPVTLIRIQTA 237 V H P V VTL++ +A++ VH+ + + V T V H P V VTL+ + +A Sbjct: 73 VVHIPLV-VTLLKATSAEEVVHIPLVVTLLKV-TSAKVVVHIPLV-VTLVEVTSA 124 >SB_43520| Best HMM Match : RNase_PH (HMM E-Value=0.00011) Length = 972 Score = 31.9 bits (69), Expect = 0.15 Identities = 13/47 (27%), Positives = 22/47 (46%) Frame = -2 Query: 174 CWNCIHKCCYHQMYWILRCLSLNQCYWNCRWMIHFHHDCWNCIHKCC 34 C+ + CY+ Y+ C CY+ C ++HH + C + CC Sbjct: 476 CYYYCYCYCYYYCYYYCYCYCYYCCYY-CYCYYYYHH--YYCCYYCC 519 >SB_49209| Best HMM Match : Vicilin_N (HMM E-Value=0.23) Length = 197 Score = 31.1 bits (67), Expect = 0.26 Identities = 16/63 (25%), Positives = 23/63 (36%) Frame = -2 Query: 216 CYWNCRWMIHFHHDCWNCIHKCCYHQMYWILRCLSLNQCYWNCRWMIHFHHDCWNCIHKC 37 C CRW + D C C + + R ++ C CRW + D C C Sbjct: 94 CKSTCRWRLDRQADIHTCKSTCRWR----LDRQADIHTCKSTCRWRLDRQADIHTCKSTC 149 Query: 36 CYR 28 +R Sbjct: 150 RWR 152 Score = 31.1 bits (67), Expect = 0.26 Identities = 16/63 (25%), Positives = 23/63 (36%) Frame = -2 Query: 216 CYWNCRWMIHFHHDCWNCIHKCCYHQMYWILRCLSLNQCYWNCRWMIHFHHDCWNCIHKC 37 C CRW + D C C + + R ++ C CRW + D C C Sbjct: 111 CKSTCRWRLDRQADIHTCKSTCRWR----LDRQADIHTCKSTCRWRLDRQADIHTCKSTC 166 Query: 36 CYR 28 +R Sbjct: 167 RWR 169 Score = 31.1 bits (67), Expect = 0.26 Identities = 16/60 (26%), Positives = 22/60 (36%) Frame = -2 Query: 216 CYWNCRWMIHFHHDCWNCIHKCCYHQMYWILRCLSLNQCYWNCRWMIHFHHDCWNCIHKC 37 C CRW + D C C + + R ++ C CRW I+ D C C Sbjct: 128 CKSTCRWRLDRQADIHTCKSTCRWR----LDRQADIHTCKSTCRWRINRQADIHRCKSTC 183 Score = 28.3 bits (60), Expect = 1.9 Identities = 15/63 (23%), Positives = 22/63 (34%) Frame = -2 Query: 216 CYWNCRWMIHFHHDCWNCIHKCCYHQMYWILRCLSLNQCYWNCRWMIHFHHDCWNCIHKC 37 C C W + D C C + + R ++ C CRW + D C C Sbjct: 77 CKSTCPWRLDRQADIHTCKSTCRWR----LDRQADIHTCKSTCRWRLDRQADIHTCKSTC 132 Query: 36 CYR 28 +R Sbjct: 133 RWR 135 Score = 27.9 bits (59), Expect = 2.4 Identities = 13/47 (27%), Positives = 19/47 (40%) Frame = -2 Query: 216 CYWNCRWMIHFHHDCWNCIHKCCYHQMYWILRCLSLNQCYWNCRWMI 76 C CRW + D C C + I R +++C CRW + Sbjct: 145 CKSTCRWRLDRQADIHTCKSTCRWR----INRQADIHRCKSTCRWQL 187 >SB_45986| Best HMM Match : Extensin_2 (HMM E-Value=0.12) Length = 1243 Score = 29.9 bits (64), Expect = 0.61 Identities = 19/56 (33%), Positives = 30/56 (53%), Gaps = 6/56 (10%) Frame = -2 Query: 159 HKCCYHQMY-WILRCLSLNQC---YWNCR-WMIHFHHDCWNC-IHKCCYRQMFWIL 10 HKCCY ++ L+C +C ++N R + +H +N HKCC+ Q+ IL Sbjct: 180 HKCCYGRIIPKYLKCEMFLRCGKNFYNLRDYRYCGNHYIFNRRFHKCCHNQVIPIL 235 >SB_30503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1402 Score = 29.9 bits (64), Expect = 0.61 Identities = 19/56 (33%), Positives = 30/56 (53%), Gaps = 6/56 (10%) Frame = -2 Query: 159 HKCCYHQMY-WILRCLSLNQC---YWNCR-WMIHFHHDCWNC-IHKCCYRQMFWIL 10 HKCCY ++ L+C +C ++N R + +H +N HKCC+ Q+ IL Sbjct: 180 HKCCYGRIIPKYLKCEMFLRCGKNFYNLRDYRYCGNHYIFNRRFHKCCHNQVIPIL 235 >SB_32428| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1128 Score = 28.3 bits (60), Expect = 1.9 Identities = 12/35 (34%), Positives = 17/35 (48%) Frame = -2 Query: 138 MYWILRCLSLNQCYWNCRWMIHFHHDCWNCIHKCC 34 M + C N C +NC H+ + +C HKCC Sbjct: 311 MQYYRGCAFANHCDFNC---THYINGSSDCNHKCC 342 Score = 28.3 bits (60), Expect = 1.9 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = -2 Query: 234 CLNSNQCYWNCRWMIHFHHDCWNCIHKCC 148 C +N C +NC H+ + +C HKCC Sbjct: 317 CAFANHCDFNC---THYINGSSDCNHKCC 342 >SB_19226| Best HMM Match : I-set (HMM E-Value=0) Length = 1500 Score = 28.3 bits (60), Expect = 1.9 Identities = 21/66 (31%), Positives = 31/66 (46%) Frame = +1 Query: 25 LAVAALMDTVPTVVMEVYHPPAVPVTLVQTQTAQDPVHLVVAALMDTVPTVVMKVYHPPA 204 + V+ ++ V VV+ V VPV +V V +VV ++ V V + V PA Sbjct: 1350 VVVSVVVVVVSVVVVVVVVVVVVPVVVVVVSVVVVVVPVVVVVVVVVVVVVSIVVVSVPA 1409 Query: 205 VPVTLI 222 V V LI Sbjct: 1410 VVVVLI 1415 >SB_15415| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1390 Score = 28.3 bits (60), Expect = 1.9 Identities = 21/66 (31%), Positives = 31/66 (46%) Frame = +1 Query: 25 LAVAALMDTVPTVVMEVYHPPAVPVTLVQTQTAQDPVHLVVAALMDTVPTVVMKVYHPPA 204 + V+ ++ V VV+ V VPV +V V +VV ++ V V + V PA Sbjct: 365 VVVSVVVVVVSVVVVVVVVVVVVPVVVVVVSVVVVVVPVVVVVVVVVVVVVSIVVVSVPA 424 Query: 205 VPVTLI 222 V V LI Sbjct: 425 VVVVLI 430 >SB_48089| Best HMM Match : DUF638 (HMM E-Value=3.3) Length = 811 Score = 28.3 bits (60), Expect = 1.9 Identities = 16/51 (31%), Positives = 25/51 (49%) Frame = +1 Query: 4 TAKDPEHLAVAALMDTVPTVVMEVYHPPAVPVTLVQTQTAQDPVHLVVAAL 156 +A P HL A+ + P ++ +HP P L+Q + VH+VV L Sbjct: 606 SAATPSHLGKVAVEEKRPRLLRSEFHPRRSP--LLQLLSNTPDVHVVVVEL 654 >SB_40994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 218 Score = 28.3 bits (60), Expect = 1.9 Identities = 16/66 (24%), Positives = 31/66 (46%), Gaps = 1/66 (1%) Frame = -2 Query: 225 SNQCYWNCRWMIHFHHDCWNCI-HKCCYHQMYWILRCLSLNQCYWNCRWMIHFHHDCWNC 49 S QC N ++ ++ C N I ++ C Q+ ++ + +QC N ++ ++ C N Sbjct: 42 SAQCGNNIKYQLYVSAQCGNNIRYQLCMFQLSVVMISSTNSQCGNNIQYQLYVSAQCGNN 101 Query: 48 IHKCCY 31 I Y Sbjct: 102 IRYQLY 107 >SB_13966| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 330 Score = 27.5 bits (58), Expect = 3.2 Identities = 15/69 (21%), Positives = 33/69 (47%), Gaps = 2/69 (2%) Frame = +1 Query: 16 PEHLAVAA--LMDTVPTVVMEVYHPPAVPVTLVQTQTAQDPVHLVVAALMDTVPTVVMKV 189 P LA+ + + T + + +P A+P+T ++L + + T P++ + Sbjct: 210 PTALAITSPIIYPTALPITSPIIYPTALPITSPTIYHTALTINL--SNYLPTAPSITSPI 267 Query: 190 YHPPAVPVT 216 +P A+P+T Sbjct: 268 IYPTALPIT 276 >SB_21618| Best HMM Match : Yip1 (HMM E-Value=1.1) Length = 338 Score = 27.1 bits (57), Expect = 4.3 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = +1 Query: 55 PTVVMEVYHPPAVPVTLVQTQTAQDPVH 138 P V E++HPP V V Q PVH Sbjct: 5 PIVAPEIHHPPQVVVHTPYEQQQLTPVH 32 >SB_53803| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 619 Score = 27.1 bits (57), Expect = 4.3 Identities = 20/59 (33%), Positives = 30/59 (50%), Gaps = 2/59 (3%) Frame = +1 Query: 49 TVPTVVMEVYHPPAVPVTLVQTQTAQDPVHLVVAALMDTVPTVVMK--VYHPPAVPVTL 219 TVP VV V + +P +V +Q P+ V ++ TVP VV+ V+ P V T+ Sbjct: 64 TVPNVVFTVPNVYYIPNVVVPNVYSQYPMWYSVPNVVFTVPNVVVTNVVFTVPNVVFTV 122 >SB_30469| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 645 Score = 27.1 bits (57), Expect = 4.3 Identities = 17/64 (26%), Positives = 30/64 (46%) Frame = +1 Query: 28 AVAALMDTVPTVVMEVYHPPAVPVTLVQTQTAQDPVHLVVAALMDTVPTVVMKVYHPPAV 207 ++ L+ VP++ V H P++ ++ Q + + V V + T V K P AV Sbjct: 321 SIKTLVTQVPSIKTSVTHVPSIKTSVTQVPSGKTSVTQVPSG--KTRHAVSFKQDIPDAV 378 Query: 208 PVTL 219 P+ L Sbjct: 379 PIPL 382 >SB_16535| Best HMM Match : ShTK (HMM E-Value=2.2e-18) Length = 101 Score = 26.6 bits (56), Expect = 5.7 Identities = 16/64 (25%), Positives = 27/64 (42%), Gaps = 1/64 (1%) Frame = -2 Query: 225 SNQCYWNCRWMIHF-HHDCWNCIHKCCYHQMYWILRCLSLNQCYWNCRWMIHFHHDCWNC 49 + +C N +WM H+ C C+ C + + +C N R+M H +C Sbjct: 44 AGECQRNTKWMFHYCPVSCGICV---CGDNNPECAKWATQGECSRNARFM---HQNCKRS 97 Query: 48 IHKC 37 +KC Sbjct: 98 CNKC 101 >SB_34085| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 296 Score = 26.2 bits (55), Expect = 7.5 Identities = 8/23 (34%), Positives = 18/23 (78%) Frame = +1 Query: 25 LAVAALMDTVPTVVMEVYHPPAV 93 +++ AL++ + T +++ YHPPA+ Sbjct: 76 ISLEALIECICTALLDSYHPPAL 98 >SB_653| Best HMM Match : Sas10_Utp3 (HMM E-Value=2.2) Length = 835 Score = 26.2 bits (55), Expect = 7.5 Identities = 15/60 (25%), Positives = 28/60 (46%) Frame = +1 Query: 1 QTAKDPEHLAVAALMDTVPTVVMEVYHPPAVPVTLVQTQTAQDPVHLVVAALMDTVPTVV 180 +T+K HL + DTV + HPP+V + ++ +Q V + ++ +V V Sbjct: 595 RTSKPTTHLPSSKQHDTVNDDTKPIPHPPSVRKSSLRKSFSQGDVRCLSPEVISSVKKTV 654 >SB_41418| Best HMM Match : EGF_CA (HMM E-Value=0) Length = 3312 Score = 25.8 bits (54), Expect = 9.9 Identities = 18/71 (25%), Positives = 30/71 (42%), Gaps = 8/71 (11%) Frame = -2 Query: 237 RCLNSNQCYWNCRWMIHFHHDCWNCI--HKCCYHQMYWI----LRCLSLNQC--YWNCRW 82 RC++ N+C N W H+C N I ++C Y + C L++C + C Sbjct: 432 RCVDINECKRNNGWC---EHECINIIGTYRCRCRDGYKLEPNRRTCQDLDECALFSGCEM 488 Query: 81 MIHFHHDCWNC 49 + H + C Sbjct: 489 LCHNTRGSYYC 499 >SB_33280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 25.8 bits (54), Expect = 9.9 Identities = 14/63 (22%), Positives = 25/63 (39%), Gaps = 3/63 (4%) Frame = +1 Query: 55 PTVVMEVYHPPAVPVTLVQT---QTAQDPVHLVVAALMDTVPTVVMKVYHPPAVPVTLIR 225 PT ++E P T+ +T +T ++P + PT + + P T+ Sbjct: 9 PTTIIETTTTTEEPTTITETTTTKTTEEPTTITETTTTTEEPTTITETTTTTEEPTTITE 68 Query: 226 IQT 234 I T Sbjct: 69 ITT 71 >SB_7831| Best HMM Match : RNA_pol_Rpb1_7 (HMM E-Value=0) Length = 1467 Score = 25.8 bits (54), Expect = 9.9 Identities = 18/71 (25%), Positives = 29/71 (40%), Gaps = 5/71 (7%) Frame = +1 Query: 16 PEHLAVAALMDTVPTVVMEVYHP-----PAVPVTLVQTQTAQDPVHLVVAALMDTVPTVV 180 P L++ L+ P + P P +P T Q+ P+ L+ + T+P Sbjct: 606 PLPLSIPLLLQATPPHLQSTAQPRPTTVPPLPPTPPPRQSTPPPLLLIPLLPLLTLPLPP 665 Query: 181 MKVYHPPAVPV 213 V HP A P+ Sbjct: 666 PTVRHPQATPL 676 >SB_39230| Best HMM Match : SNF2_N (HMM E-Value=1.40004e-41) Length = 1682 Score = 25.8 bits (54), Expect = 9.9 Identities = 7/24 (29%), Positives = 15/24 (62%) Frame = -2 Query: 162 IHKCCYHQMYWILRCLSLNQCYWN 91 +++C +H +W L NQC+++ Sbjct: 1436 LYQCYFHSAFWHLYTRKENQCFFH 1459 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,443,480 Number of Sequences: 59808 Number of extensions: 175149 Number of successful extensions: 464 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 354 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 455 length of database: 16,821,457 effective HSP length: 73 effective length of database: 12,455,473 effective search space used: 535585339 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -